Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EAX1

Protein Details
Accession A0A177EAX1    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
121-143FYSKNPYEKKPIKRAAKQLVLKWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, nucl 9, pero 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035441  TFIIS/LEDGF_dom_sf  
IPR017923  TFIIS_N  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08711  Med26  
PROSITE View protein in PROSITE  
PS51319  TFIIS_N  
Amino Acid Sequences MNEEKEQAETLIVYDTKYVKDLIEEIEAAAEEDQRLNQEGKPALHKLFLMDTIYNKLLNRKIHLELLDSGILGALRKWLEPLPNNSLPSDEVKKGIIDILQHFHPMKEHLIESGIGKIILFYSKNPYEKKPIKRAAKQLVLKWIEVAAERDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.16
5 0.16
6 0.12
7 0.14
8 0.15
9 0.14
10 0.15
11 0.14
12 0.13
13 0.13
14 0.13
15 0.11
16 0.1
17 0.08
18 0.06
19 0.07
20 0.07
21 0.08
22 0.1
23 0.11
24 0.11
25 0.16
26 0.19
27 0.21
28 0.25
29 0.27
30 0.26
31 0.26
32 0.25
33 0.21
34 0.19
35 0.19
36 0.16
37 0.14
38 0.14
39 0.16
40 0.17
41 0.17
42 0.16
43 0.19
44 0.22
45 0.23
46 0.25
47 0.25
48 0.26
49 0.28
50 0.28
51 0.26
52 0.22
53 0.22
54 0.19
55 0.15
56 0.12
57 0.1
58 0.09
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.07
65 0.08
66 0.12
67 0.15
68 0.19
69 0.25
70 0.28
71 0.29
72 0.28
73 0.28
74 0.25
75 0.26
76 0.25
77 0.18
78 0.16
79 0.16
80 0.16
81 0.15
82 0.15
83 0.12
84 0.1
85 0.11
86 0.13
87 0.13
88 0.16
89 0.16
90 0.15
91 0.15
92 0.15
93 0.15
94 0.15
95 0.15
96 0.13
97 0.14
98 0.14
99 0.14
100 0.14
101 0.12
102 0.1
103 0.09
104 0.09
105 0.08
106 0.1
107 0.1
108 0.1
109 0.17
110 0.23
111 0.29
112 0.33
113 0.36
114 0.44
115 0.53
116 0.61
117 0.64
118 0.68
119 0.73
120 0.78
121 0.84
122 0.84
123 0.85
124 0.81
125 0.76
126 0.76
127 0.68
128 0.6
129 0.51
130 0.41
131 0.33
132 0.28