Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EKX5

Protein Details
Accession A0A177EKX5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
215-238DYLKGKEKTAPKTRKPSASKSSSKHydrophilic
NLS Segment(s)
PositionSequence
221-231EKTAPKTRKPS
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037278  ARFGAP/RecO  
IPR001164  ArfGAP_dom  
IPR038508  ArfGAP_dom_sf  
Gene Ontology GO:0005096  F:GTPase activator activity  
Pfam View protein in Pfam  
PF01412  ArfGap  
PROSITE View protein in PROSITE  
PS50115  ARFGAP  
Amino Acid Sequences MPEESSPTLKEIIERSPENKTCADCGMARPQWSSITYGIFLCLNCAGVHRSFGVKVSIVKSIGMDMWPPRDLKKMELGGNARFHAYLSKHNLSQLPKDKLYFESRVSEFAQALEKEVQALCPEQPRKPEPAPKASAQPPRRHSPSPPTVAVQGSRLSPSYATQTAPTLQANVSDMLGRAAGYLYTGASTLSGHFSEKILAPATVAIKEKSEQLADYLKGKEKTAPKTRKPSASKSSSKAPTSTSTKTSFDKWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.41
4 0.44
5 0.44
6 0.45
7 0.41
8 0.36
9 0.35
10 0.35
11 0.27
12 0.29
13 0.35
14 0.35
15 0.35
16 0.34
17 0.33
18 0.33
19 0.32
20 0.31
21 0.22
22 0.21
23 0.2
24 0.19
25 0.18
26 0.17
27 0.15
28 0.14
29 0.13
30 0.11
31 0.1
32 0.12
33 0.14
34 0.13
35 0.14
36 0.14
37 0.15
38 0.15
39 0.16
40 0.16
41 0.15
42 0.18
43 0.18
44 0.2
45 0.19
46 0.19
47 0.17
48 0.16
49 0.15
50 0.12
51 0.13
52 0.11
53 0.14
54 0.15
55 0.16
56 0.17
57 0.23
58 0.23
59 0.24
60 0.3
61 0.31
62 0.32
63 0.37
64 0.39
65 0.37
66 0.38
67 0.36
68 0.29
69 0.24
70 0.21
71 0.2
72 0.19
73 0.21
74 0.26
75 0.28
76 0.28
77 0.3
78 0.35
79 0.33
80 0.4
81 0.42
82 0.39
83 0.38
84 0.39
85 0.38
86 0.37
87 0.4
88 0.35
89 0.27
90 0.28
91 0.27
92 0.28
93 0.28
94 0.26
95 0.2
96 0.18
97 0.2
98 0.14
99 0.16
100 0.14
101 0.12
102 0.12
103 0.12
104 0.11
105 0.08
106 0.09
107 0.08
108 0.14
109 0.16
110 0.17
111 0.22
112 0.24
113 0.29
114 0.32
115 0.39
116 0.37
117 0.42
118 0.44
119 0.41
120 0.45
121 0.46
122 0.51
123 0.49
124 0.52
125 0.5
126 0.53
127 0.57
128 0.53
129 0.5
130 0.5
131 0.52
132 0.49
133 0.46
134 0.4
135 0.37
136 0.36
137 0.33
138 0.25
139 0.19
140 0.14
141 0.14
142 0.13
143 0.11
144 0.11
145 0.11
146 0.14
147 0.14
148 0.14
149 0.14
150 0.15
151 0.15
152 0.17
153 0.16
154 0.13
155 0.11
156 0.11
157 0.12
158 0.11
159 0.1
160 0.09
161 0.09
162 0.08
163 0.08
164 0.07
165 0.06
166 0.05
167 0.05
168 0.04
169 0.05
170 0.04
171 0.04
172 0.05
173 0.04
174 0.04
175 0.05
176 0.06
177 0.08
178 0.08
179 0.09
180 0.1
181 0.1
182 0.12
183 0.13
184 0.14
185 0.13
186 0.12
187 0.12
188 0.14
189 0.15
190 0.16
191 0.17
192 0.15
193 0.16
194 0.17
195 0.19
196 0.19
197 0.19
198 0.16
199 0.17
200 0.22
201 0.22
202 0.25
203 0.26
204 0.31
205 0.31
206 0.32
207 0.36
208 0.38
209 0.47
210 0.54
211 0.6
212 0.63
213 0.72
214 0.79
215 0.82
216 0.82
217 0.82
218 0.81
219 0.8
220 0.79
221 0.73
222 0.75
223 0.73
224 0.69
225 0.61
226 0.55
227 0.53
228 0.53
229 0.53
230 0.48
231 0.45
232 0.46
233 0.48