Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177EJ86

Protein Details
Accession A0A177EJ86    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-43GDPLPKKPLKTSKKEKENSIHydrophilic
76-101LAKFPCKLFHIKKNCRRRNCQFSHAPHydrophilic
NLS Segment(s)
PositionSequence
27-39LPKKPLKTSKKEK
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045124  Su(sable)-like  
IPR041367  Znf-CCCH_4  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0016070  P:RNA metabolic process  
Pfam View protein in Pfam  
PF14608  zf-CCCH_2  
PF18044  zf-CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MKTVELPQLPKLQVPLFRERRESGDPLPKKPLKTSKKEKENSIIKNIYKPEKKHLCKYFVKNACIRGSNCTFSHDLAKFPCKLFHIKKNCRRRNCQFSHAPISEEETQMLVSEGWELEKEEKEEEFISPFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.45
4 0.48
5 0.52
6 0.5
7 0.53
8 0.52
9 0.51
10 0.47
11 0.5
12 0.5
13 0.49
14 0.57
15 0.54
16 0.51
17 0.55
18 0.58
19 0.57
20 0.63
21 0.7
22 0.71
23 0.78
24 0.81
25 0.78
26 0.77
27 0.77
28 0.71
29 0.68
30 0.64
31 0.54
32 0.54
33 0.53
34 0.52
35 0.49
36 0.47
37 0.48
38 0.53
39 0.57
40 0.61
41 0.64
42 0.63
43 0.64
44 0.68
45 0.68
46 0.65
47 0.64
48 0.57
49 0.55
50 0.5
51 0.46
52 0.4
53 0.35
54 0.31
55 0.31
56 0.28
57 0.26
58 0.24
59 0.21
60 0.27
61 0.22
62 0.21
63 0.2
64 0.24
65 0.23
66 0.22
67 0.24
68 0.2
69 0.28
70 0.32
71 0.39
72 0.47
73 0.56
74 0.65
75 0.74
76 0.81
77 0.82
78 0.86
79 0.86
80 0.86
81 0.82
82 0.81
83 0.78
84 0.76
85 0.76
86 0.67
87 0.58
88 0.48
89 0.47
90 0.4
91 0.33
92 0.26
93 0.17
94 0.16
95 0.14
96 0.15
97 0.09
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.09
104 0.12
105 0.15
106 0.17
107 0.18
108 0.18
109 0.2
110 0.2
111 0.2