Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8Y399

Protein Details
Accession G8Y399    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-98TSRKPDSYSKEKPWRSSKKKKKDRIYFBasic
NLS Segment(s)
PositionSequence
81-95KEKPWRSSKKKKKDR
Subcellular Location(s) nucl 12.5, cysk 8, cyto_nucl 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000683  Gfo/Idh/MocA-like_OxRdtase_N  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0000166  F:nucleotide binding  
Pfam View protein in Pfam  
PF01408  GFO_IDH_MocA  
Amino Acid Sequences MGLKVASKGIDILMEKPLAPTIEECRTLIDFCNNRGVKLLVGHHRRFNPYIVASKAHISKVGEIMAVQGCWTSRKPDSYSKEKPWRSSKKKKKDRIYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.17
5 0.14
6 0.13
7 0.14
8 0.16
9 0.2
10 0.22
11 0.21
12 0.22
13 0.23
14 0.23
15 0.22
16 0.25
17 0.22
18 0.22
19 0.32
20 0.29
21 0.28
22 0.29
23 0.28
24 0.21
25 0.22
26 0.25
27 0.24
28 0.32
29 0.34
30 0.36
31 0.38
32 0.41
33 0.39
34 0.35
35 0.3
36 0.25
37 0.27
38 0.23
39 0.23
40 0.2
41 0.22
42 0.22
43 0.19
44 0.19
45 0.16
46 0.16
47 0.16
48 0.15
49 0.12
50 0.1
51 0.12
52 0.1
53 0.09
54 0.08
55 0.07
56 0.07
57 0.09
58 0.1
59 0.13
60 0.16
61 0.21
62 0.26
63 0.35
64 0.42
65 0.5
66 0.58
67 0.64
68 0.71
69 0.72
70 0.76
71 0.78
72 0.82
73 0.83
74 0.85
75 0.86
76 0.87
77 0.92
78 0.94