Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YEJ4

Protein Details
Accession G8YEJ4   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
471-492FKNTMKYYRKVLKRVRDNEIIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029209  DML1/Misato_tubulin  
IPR019605  Misato_II_tubulin-like  
IPR036525  Tubulin/FtsZ_GTPase_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0006996  P:organelle organization  
Pfam View protein in Pfam  
PF10644  Misat_Tub_SegII  
PF14881  Tubulin_3  
Amino Acid Sequences MHEVIDLSFGHTSNHVGAHLYNVQESHIPYKRDTVLSHDNNVFLSSYRGGSVTYTPRAIIYEHTGGYGPLGKYEYYEPKVEVPKNLQVIQTREKVPKNEYQLALDEGKNMPGALDVSSTRYWSGYSKLLYNPKSMNTLASWEHPEGSNIEGKDGKTSSLGFNRQVPKLLFDTFDKGVESYKDEAENSMDQFRNTLEKCDMIQGLNFVTELDTAWAGFTNSFITDMKDEFFNSGINNKHNIWVHTLSDNVASSTLKTNSLLSRIKATIELASNSTLLFPMAIDPNLQVLNQSFDHESNWHKSNVFAFMINSLWGLNNQLQDPVRMSQIQDELLRGYSSRKVVDSLKIHQVNKPNSSPQIQDISLKDIANIDVLHNMVQDMDITKSSSLNLGLYSSMDRCSYNDFPGAFLSKSYIASPNEHSLIEKLEEQKGPVNLYKNKYVDEVSKIDTTPKIWNSDSHFIELCIGSSQGGFKNTMKYYRKVLKRVRDNEIIEDRSELIEQISGLIDEYTTGYESDSDEDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.14
4 0.14
5 0.18
6 0.21
7 0.2
8 0.2
9 0.19
10 0.19
11 0.21
12 0.23
13 0.27
14 0.29
15 0.31
16 0.31
17 0.38
18 0.41
19 0.42
20 0.41
21 0.4
22 0.45
23 0.47
24 0.52
25 0.47
26 0.43
27 0.39
28 0.39
29 0.31
30 0.21
31 0.2
32 0.15
33 0.14
34 0.14
35 0.14
36 0.13
37 0.15
38 0.2
39 0.23
40 0.25
41 0.25
42 0.25
43 0.25
44 0.26
45 0.25
46 0.22
47 0.22
48 0.22
49 0.22
50 0.22
51 0.22
52 0.21
53 0.21
54 0.24
55 0.17
56 0.15
57 0.17
58 0.15
59 0.17
60 0.23
61 0.3
62 0.27
63 0.3
64 0.29
65 0.34
66 0.43
67 0.43
68 0.43
69 0.4
70 0.44
71 0.46
72 0.47
73 0.45
74 0.42
75 0.46
76 0.47
77 0.47
78 0.46
79 0.48
80 0.51
81 0.52
82 0.51
83 0.52
84 0.54
85 0.56
86 0.52
87 0.47
88 0.45
89 0.44
90 0.42
91 0.35
92 0.29
93 0.22
94 0.21
95 0.19
96 0.16
97 0.12
98 0.1
99 0.1
100 0.08
101 0.09
102 0.09
103 0.13
104 0.13
105 0.14
106 0.14
107 0.13
108 0.14
109 0.14
110 0.17
111 0.18
112 0.19
113 0.22
114 0.28
115 0.36
116 0.37
117 0.39
118 0.38
119 0.35
120 0.38
121 0.34
122 0.3
123 0.22
124 0.24
125 0.21
126 0.22
127 0.24
128 0.2
129 0.21
130 0.19
131 0.2
132 0.17
133 0.17
134 0.18
135 0.14
136 0.16
137 0.17
138 0.17
139 0.2
140 0.19
141 0.18
142 0.15
143 0.17
144 0.19
145 0.23
146 0.26
147 0.25
148 0.31
149 0.36
150 0.35
151 0.39
152 0.35
153 0.31
154 0.31
155 0.3
156 0.25
157 0.21
158 0.25
159 0.21
160 0.21
161 0.19
162 0.16
163 0.16
164 0.15
165 0.17
166 0.14
167 0.15
168 0.15
169 0.15
170 0.15
171 0.17
172 0.17
173 0.15
174 0.19
175 0.18
176 0.17
177 0.17
178 0.17
179 0.21
180 0.2
181 0.21
182 0.17
183 0.17
184 0.18
185 0.21
186 0.21
187 0.15
188 0.15
189 0.12
190 0.12
191 0.1
192 0.1
193 0.07
194 0.06
195 0.06
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.06
208 0.07
209 0.08
210 0.08
211 0.09
212 0.09
213 0.09
214 0.09
215 0.09
216 0.09
217 0.08
218 0.08
219 0.11
220 0.13
221 0.14
222 0.17
223 0.17
224 0.21
225 0.22
226 0.22
227 0.23
228 0.22
229 0.22
230 0.2
231 0.2
232 0.16
233 0.15
234 0.15
235 0.1
236 0.09
237 0.07
238 0.07
239 0.1
240 0.1
241 0.1
242 0.1
243 0.12
244 0.12
245 0.17
246 0.18
247 0.16
248 0.19
249 0.18
250 0.18
251 0.17
252 0.17
253 0.14
254 0.13
255 0.13
256 0.11
257 0.11
258 0.11
259 0.1
260 0.09
261 0.07
262 0.06
263 0.05
264 0.04
265 0.05
266 0.06
267 0.06
268 0.06
269 0.06
270 0.08
271 0.08
272 0.08
273 0.07
274 0.06
275 0.09
276 0.09
277 0.11
278 0.1
279 0.1
280 0.12
281 0.13
282 0.16
283 0.17
284 0.19
285 0.19
286 0.18
287 0.19
288 0.19
289 0.21
290 0.19
291 0.15
292 0.13
293 0.13
294 0.13
295 0.12
296 0.11
297 0.07
298 0.06
299 0.06
300 0.08
301 0.09
302 0.1
303 0.1
304 0.13
305 0.13
306 0.14
307 0.16
308 0.15
309 0.15
310 0.14
311 0.14
312 0.15
313 0.16
314 0.17
315 0.15
316 0.15
317 0.14
318 0.14
319 0.13
320 0.1
321 0.11
322 0.13
323 0.15
324 0.15
325 0.15
326 0.17
327 0.19
328 0.27
329 0.29
330 0.29
331 0.37
332 0.41
333 0.42
334 0.43
335 0.49
336 0.47
337 0.48
338 0.47
339 0.42
340 0.39
341 0.41
342 0.39
343 0.34
344 0.33
345 0.29
346 0.29
347 0.26
348 0.28
349 0.28
350 0.26
351 0.23
352 0.19
353 0.18
354 0.16
355 0.15
356 0.11
357 0.09
358 0.09
359 0.09
360 0.08
361 0.08
362 0.06
363 0.06
364 0.06
365 0.06
366 0.07
367 0.07
368 0.08
369 0.09
370 0.09
371 0.09
372 0.1
373 0.1
374 0.09
375 0.09
376 0.09
377 0.08
378 0.09
379 0.11
380 0.1
381 0.11
382 0.11
383 0.11
384 0.12
385 0.19
386 0.2
387 0.21
388 0.25
389 0.23
390 0.23
391 0.25
392 0.27
393 0.2
394 0.18
395 0.18
396 0.15
397 0.16
398 0.17
399 0.2
400 0.19
401 0.23
402 0.26
403 0.29
404 0.29
405 0.28
406 0.27
407 0.22
408 0.23
409 0.22
410 0.22
411 0.2
412 0.24
413 0.25
414 0.25
415 0.29
416 0.29
417 0.31
418 0.31
419 0.35
420 0.37
421 0.41
422 0.47
423 0.44
424 0.44
425 0.42
426 0.41
427 0.37
428 0.36
429 0.35
430 0.31
431 0.32
432 0.3
433 0.32
434 0.3
435 0.28
436 0.31
437 0.31
438 0.32
439 0.31
440 0.35
441 0.4
442 0.47
443 0.46
444 0.42
445 0.39
446 0.34
447 0.36
448 0.31
449 0.24
450 0.16
451 0.15
452 0.11
453 0.11
454 0.13
455 0.14
456 0.15
457 0.18
458 0.19
459 0.26
460 0.3
461 0.39
462 0.41
463 0.42
464 0.5
465 0.56
466 0.63
467 0.65
468 0.72
469 0.73
470 0.78
471 0.82
472 0.81
473 0.8
474 0.75
475 0.73
476 0.72
477 0.64
478 0.54
479 0.48
480 0.41
481 0.33
482 0.3
483 0.22
484 0.14
485 0.12
486 0.11
487 0.11
488 0.1
489 0.09
490 0.09
491 0.09
492 0.08
493 0.07
494 0.08
495 0.08
496 0.08
497 0.09
498 0.09
499 0.1
500 0.11
501 0.13