Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8XZU1

Protein Details
Accession G8XZU1   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-42TANPPKAKKGTTPKRNKAKRGLVSFDHydrophilic
NLS Segment(s)
PositionSequence
21-36PKAKKGTTPKRNKAKR
Subcellular Location(s) nucl 20.5, cyto_nucl 15, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGHEFIDRIQNSVTSATANPPKAKKGTTPKRNKAKRGLVSFDFEDDEIVNYDNTDVSAIEQPSNRLPTLDSKVRYMNKAMKNEMSRLQDNEFAKHKLDSENKEKEVLLLILENFETLNIEDFFETNTITHTTLFRLFVYASYHNQAEYFARAMKDNLHIVHYKEVLRKLMHVRELDFNLKDKFTKDGYIEHDDTCVECRKAESIEIPSIVLKRLDVVDIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.2
4 0.26
5 0.3
6 0.34
7 0.36
8 0.42
9 0.44
10 0.46
11 0.48
12 0.52
13 0.59
14 0.64
15 0.72
16 0.77
17 0.84
18 0.9
19 0.9
20 0.89
21 0.88
22 0.86
23 0.83
24 0.8
25 0.72
26 0.68
27 0.6
28 0.51
29 0.41
30 0.32
31 0.25
32 0.18
33 0.16
34 0.11
35 0.11
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.06
42 0.05
43 0.07
44 0.11
45 0.12
46 0.14
47 0.15
48 0.17
49 0.2
50 0.23
51 0.2
52 0.16
53 0.17
54 0.21
55 0.27
56 0.32
57 0.3
58 0.3
59 0.36
60 0.39
61 0.39
62 0.38
63 0.4
64 0.4
65 0.43
66 0.44
67 0.43
68 0.42
69 0.43
70 0.44
71 0.41
72 0.36
73 0.33
74 0.32
75 0.32
76 0.3
77 0.31
78 0.28
79 0.25
80 0.24
81 0.22
82 0.22
83 0.22
84 0.28
85 0.3
86 0.35
87 0.39
88 0.39
89 0.39
90 0.38
91 0.32
92 0.27
93 0.21
94 0.13
95 0.08
96 0.07
97 0.06
98 0.06
99 0.06
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.07
111 0.07
112 0.05
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.1
119 0.12
120 0.13
121 0.11
122 0.11
123 0.11
124 0.11
125 0.15
126 0.16
127 0.16
128 0.17
129 0.18
130 0.17
131 0.16
132 0.16
133 0.13
134 0.12
135 0.12
136 0.12
137 0.12
138 0.13
139 0.14
140 0.15
141 0.18
142 0.19
143 0.18
144 0.19
145 0.2
146 0.21
147 0.25
148 0.25
149 0.25
150 0.27
151 0.29
152 0.3
153 0.29
154 0.32
155 0.35
156 0.38
157 0.4
158 0.37
159 0.37
160 0.38
161 0.41
162 0.42
163 0.36
164 0.34
165 0.31
166 0.31
167 0.3
168 0.25
169 0.25
170 0.22
171 0.25
172 0.23
173 0.26
174 0.31
175 0.38
176 0.38
177 0.35
178 0.33
179 0.29
180 0.29
181 0.27
182 0.27
183 0.19
184 0.18
185 0.2
186 0.21
187 0.23
188 0.25
189 0.26
190 0.25
191 0.29
192 0.29
193 0.28
194 0.28
195 0.27
196 0.27
197 0.22
198 0.17
199 0.15
200 0.16