Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G8YCN5

Protein Details
Accession G8YCN5   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVNVPKTRKTYCKGKNCRKHTQHRVTQYKAGKHydrophilic
NLS Segment(s)
PositionSequence
42-42R
45-48RKQR
59-62HKKA
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKNCRKHTQHRVTQYKAGKASLFAQGKRRYDRKQRGYGGQTKPVFHKKAKVTKKVVLRLECVVCKTKAQLGLKRCKHFELGGDKKKKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.9
5 0.89
6 0.9
7 0.91
8 0.9
9 0.88
10 0.88
11 0.88
12 0.82
13 0.8
14 0.75
15 0.69
16 0.6
17 0.53
18 0.43
19 0.35
20 0.32
21 0.33
22 0.31
23 0.27
24 0.33
25 0.38
26 0.42
27 0.47
28 0.52
29 0.51
30 0.58
31 0.67
32 0.68
33 0.7
34 0.7
35 0.7
36 0.7
37 0.72
38 0.64
39 0.62
40 0.54
41 0.46
42 0.47
43 0.47
44 0.44
45 0.36
46 0.4
47 0.4
48 0.48
49 0.56
50 0.6
51 0.59
52 0.61
53 0.68
54 0.69
55 0.67
56 0.6
57 0.54
58 0.5
59 0.47
60 0.43
61 0.37
62 0.33
63 0.27
64 0.26
65 0.25
66 0.24
67 0.28
68 0.33
69 0.37
70 0.42
71 0.52
72 0.6
73 0.64
74 0.63
75 0.58
76 0.55
77 0.5
78 0.49
79 0.49
80 0.51
81 0.55
82 0.6
83 0.59
84 0.61
85 0.64
86 0.62