Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B9M9

Protein Details
Accession G3B9M9   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-52TYANEHKKLERRTKNSKKPSEKSASNHydrophilic
120-141PAVPPSAETKDKKKKKKKSGKKBasic
NLS Segment(s)
PositionSequence
36-44ERRTKNSKK
129-141KDKKKKKKKSGKK
Subcellular Location(s) nucl 15, cyto_nucl 9.833, mito 9.5, cyto_mito 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
KEGG cten:CANTEDRAFT_99046  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSTLDTFISSTAKLLAAYPTTARVSITYANEHKKLERRTKNSKKPSEKSASNYVSFKVFEPSSGKVIKYKTYKVKELSKLITFLGPRGVTSNDAQKVPGLSSIMSNKKFDESEKLDTLVPAVPPSAETKDKKKKKKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.14
5 0.14
6 0.16
7 0.17
8 0.17
9 0.16
10 0.14
11 0.16
12 0.19
13 0.21
14 0.23
15 0.28
16 0.34
17 0.36
18 0.37
19 0.39
20 0.42
21 0.49
22 0.53
23 0.58
24 0.6
25 0.69
26 0.79
27 0.85
28 0.87
29 0.89
30 0.88
31 0.83
32 0.84
33 0.81
34 0.75
35 0.7
36 0.69
37 0.62
38 0.54
39 0.5
40 0.41
41 0.35
42 0.31
43 0.26
44 0.2
45 0.15
46 0.14
47 0.16
48 0.17
49 0.19
50 0.2
51 0.19
52 0.19
53 0.2
54 0.25
55 0.26
56 0.31
57 0.36
58 0.39
59 0.44
60 0.45
61 0.52
62 0.52
63 0.53
64 0.5
65 0.42
66 0.39
67 0.35
68 0.32
69 0.24
70 0.19
71 0.18
72 0.14
73 0.13
74 0.14
75 0.15
76 0.14
77 0.15
78 0.22
79 0.2
80 0.2
81 0.2
82 0.19
83 0.19
84 0.17
85 0.17
86 0.11
87 0.09
88 0.12
89 0.19
90 0.25
91 0.26
92 0.27
93 0.26
94 0.28
95 0.29
96 0.28
97 0.3
98 0.29
99 0.33
100 0.34
101 0.35
102 0.32
103 0.31
104 0.31
105 0.24
106 0.19
107 0.13
108 0.11
109 0.1
110 0.11
111 0.15
112 0.19
113 0.24
114 0.28
115 0.38
116 0.49
117 0.59
118 0.69
119 0.76
120 0.82
121 0.86