Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8Y8T4

Protein Details
Accession G8Y8T4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MESNRIKKANRKNTSHLKSKIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MESNRIKKANRKNTSHLKSKIERSNRNSGILSNKIEQSIARANYIQKYRKADWEKINKEINSGAVMNEDDDSLQTKKQIEREEEDEYVKQFFDEDNDKKDEGDESQDTGSNDYSAQGNKFAILDEIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.79
4 0.77
5 0.74
6 0.76
7 0.76
8 0.75
9 0.77
10 0.73
11 0.77
12 0.71
13 0.68
14 0.59
15 0.52
16 0.49
17 0.44
18 0.41
19 0.33
20 0.32
21 0.28
22 0.27
23 0.24
24 0.22
25 0.24
26 0.21
27 0.2
28 0.2
29 0.22
30 0.27
31 0.34
32 0.34
33 0.33
34 0.38
35 0.39
36 0.47
37 0.51
38 0.52
39 0.55
40 0.61
41 0.59
42 0.58
43 0.63
44 0.53
45 0.48
46 0.41
47 0.33
48 0.23
49 0.2
50 0.14
51 0.09
52 0.09
53 0.08
54 0.07
55 0.07
56 0.05
57 0.05
58 0.07
59 0.07
60 0.08
61 0.09
62 0.12
63 0.14
64 0.19
65 0.25
66 0.26
67 0.29
68 0.34
69 0.36
70 0.35
71 0.35
72 0.31
73 0.27
74 0.24
75 0.19
76 0.14
77 0.1
78 0.09
79 0.11
80 0.18
81 0.2
82 0.24
83 0.27
84 0.27
85 0.27
86 0.28
87 0.25
88 0.19
89 0.22
90 0.19
91 0.18
92 0.19
93 0.22
94 0.21
95 0.22
96 0.21
97 0.15
98 0.14
99 0.13
100 0.14
101 0.14
102 0.15
103 0.16
104 0.15
105 0.16
106 0.16
107 0.15
108 0.14