Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L7X2Y4

Protein Details
Accession A0A1L7X2Y4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
209-231VVSAPPPKEKKRPWTKAAPAEPTHydrophilic
NLS Segment(s)
PositionSequence
157-169KPARGKAKAKKVK
214-237PPKEKKRPWTKAAPAEPTASKASK
249-256RRSGRTKK
Subcellular Location(s) mito 20, cyto_mito 12.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MPAASRTVKSIISKTLSIVKAQDNANVFGKVGTNGAEFQKALTGKKVISAICKEDEKQARPCQGPPPGSSKHQWNWKLGRTLANFPKSGCSIIAGGKGKKDAPTSLPNGQKITFLTVGGRTSCVVPSVQKKTGAVAGDLKKENLENLEKGEESEAMKPARGKAKAKKVKEETEEDEKVKVEEDQPLAKSNGTSSRKRKNPAAIEEPEFVVSAPPPKEKKRPWTKAAPAEPTASKASKAKVDDTPSTSNRRSGRTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.36
4 0.34
5 0.34
6 0.31
7 0.32
8 0.33
9 0.35
10 0.29
11 0.31
12 0.32
13 0.29
14 0.26
15 0.21
16 0.21
17 0.17
18 0.15
19 0.13
20 0.11
21 0.13
22 0.15
23 0.16
24 0.14
25 0.14
26 0.18
27 0.19
28 0.19
29 0.2
30 0.21
31 0.19
32 0.23
33 0.26
34 0.22
35 0.27
36 0.29
37 0.29
38 0.31
39 0.34
40 0.31
41 0.37
42 0.43
43 0.41
44 0.46
45 0.49
46 0.52
47 0.51
48 0.53
49 0.52
50 0.52
51 0.51
52 0.45
53 0.45
54 0.42
55 0.44
56 0.44
57 0.45
58 0.43
59 0.49
60 0.51
61 0.52
62 0.54
63 0.56
64 0.58
65 0.53
66 0.54
67 0.48
68 0.52
69 0.52
70 0.49
71 0.44
72 0.39
73 0.4
74 0.33
75 0.3
76 0.22
77 0.16
78 0.13
79 0.14
80 0.2
81 0.2
82 0.2
83 0.2
84 0.21
85 0.21
86 0.22
87 0.23
88 0.18
89 0.19
90 0.24
91 0.28
92 0.33
93 0.36
94 0.35
95 0.36
96 0.34
97 0.31
98 0.26
99 0.24
100 0.18
101 0.14
102 0.13
103 0.12
104 0.13
105 0.12
106 0.12
107 0.09
108 0.09
109 0.09
110 0.08
111 0.08
112 0.1
113 0.16
114 0.21
115 0.23
116 0.23
117 0.23
118 0.23
119 0.26
120 0.23
121 0.18
122 0.19
123 0.19
124 0.23
125 0.23
126 0.22
127 0.2
128 0.19
129 0.19
130 0.15
131 0.15
132 0.11
133 0.13
134 0.14
135 0.14
136 0.14
137 0.14
138 0.12
139 0.11
140 0.12
141 0.14
142 0.13
143 0.14
144 0.15
145 0.18
146 0.24
147 0.27
148 0.32
149 0.37
150 0.48
151 0.56
152 0.59
153 0.65
154 0.65
155 0.68
156 0.67
157 0.64
158 0.59
159 0.58
160 0.58
161 0.49
162 0.43
163 0.36
164 0.31
165 0.25
166 0.21
167 0.14
168 0.15
169 0.17
170 0.19
171 0.2
172 0.23
173 0.23
174 0.22
175 0.21
176 0.18
177 0.26
178 0.28
179 0.35
180 0.4
181 0.5
182 0.57
183 0.62
184 0.67
185 0.67
186 0.7
187 0.7
188 0.7
189 0.65
190 0.63
191 0.59
192 0.52
193 0.43
194 0.34
195 0.26
196 0.18
197 0.14
198 0.16
199 0.17
200 0.23
201 0.28
202 0.35
203 0.45
204 0.52
205 0.62
206 0.68
207 0.75
208 0.75
209 0.8
210 0.83
211 0.84
212 0.84
213 0.8
214 0.71
215 0.66
216 0.59
217 0.52
218 0.48
219 0.38
220 0.33
221 0.3
222 0.31
223 0.33
224 0.35
225 0.36
226 0.38
227 0.44
228 0.47
229 0.49
230 0.53
231 0.52
232 0.57
233 0.54
234 0.55
235 0.53
236 0.54