Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YEW1

Protein Details
Accession G8YEW1    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
205-229RSDFRNKFQKSSKKKRLSDEEEQIWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002661  Ribosome_recyc_fac  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Gene Ontology GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MFGILRSLTGLRAYRGFIPQPKVHYVRSSQFHTAMILSKKAKVKSGATNKAKKGAQVEENTDASSAEASNIDFDDANAKFTSVLEKFKKHANDAKLGKTNPDIFDKLTIATSNGDVPFNQVAQSSIKGRNFVITVFDPSNSQSIVNSVLASDLNMNPQVDPTNKSTLKVPLPPVTTESKKENTKQLKAVFEKFKNGGKVSLASVRSDFRNKFQKSSKKKRLSDEEEQIWKNFEKLHKEYTDKLSSIYKEAEQKILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.34
4 0.36
5 0.41
6 0.43
7 0.46
8 0.52
9 0.53
10 0.5
11 0.5
12 0.49
13 0.5
14 0.52
15 0.52
16 0.48
17 0.46
18 0.43
19 0.39
20 0.34
21 0.32
22 0.29
23 0.29
24 0.27
25 0.31
26 0.37
27 0.37
28 0.41
29 0.39
30 0.42
31 0.46
32 0.55
33 0.6
34 0.63
35 0.7
36 0.68
37 0.7
38 0.66
39 0.58
40 0.53
41 0.49
42 0.47
43 0.43
44 0.45
45 0.42
46 0.42
47 0.39
48 0.34
49 0.27
50 0.19
51 0.15
52 0.1
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.11
62 0.11
63 0.13
64 0.12
65 0.12
66 0.11
67 0.12
68 0.17
69 0.14
70 0.21
71 0.23
72 0.26
73 0.27
74 0.33
75 0.36
76 0.35
77 0.41
78 0.37
79 0.42
80 0.44
81 0.49
82 0.49
83 0.46
84 0.43
85 0.4
86 0.39
87 0.32
88 0.32
89 0.27
90 0.21
91 0.23
92 0.22
93 0.19
94 0.15
95 0.13
96 0.1
97 0.1
98 0.09
99 0.1
100 0.1
101 0.09
102 0.09
103 0.11
104 0.11
105 0.1
106 0.1
107 0.08
108 0.08
109 0.09
110 0.11
111 0.12
112 0.16
113 0.16
114 0.17
115 0.17
116 0.18
117 0.17
118 0.16
119 0.16
120 0.12
121 0.14
122 0.13
123 0.14
124 0.13
125 0.13
126 0.14
127 0.11
128 0.1
129 0.07
130 0.07
131 0.09
132 0.09
133 0.08
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.06
140 0.07
141 0.09
142 0.09
143 0.08
144 0.09
145 0.11
146 0.12
147 0.14
148 0.17
149 0.24
150 0.24
151 0.25
152 0.27
153 0.3
154 0.32
155 0.34
156 0.35
157 0.32
158 0.34
159 0.34
160 0.34
161 0.35
162 0.34
163 0.33
164 0.34
165 0.35
166 0.38
167 0.41
168 0.48
169 0.5
170 0.52
171 0.56
172 0.56
173 0.58
174 0.57
175 0.62
176 0.61
177 0.55
178 0.55
179 0.51
180 0.51
181 0.47
182 0.44
183 0.38
184 0.31
185 0.3
186 0.27
187 0.31
188 0.27
189 0.23
190 0.24
191 0.24
192 0.26
193 0.32
194 0.31
195 0.32
196 0.42
197 0.43
198 0.48
199 0.56
200 0.63
201 0.66
202 0.76
203 0.8
204 0.8
205 0.84
206 0.86
207 0.88
208 0.86
209 0.84
210 0.82
211 0.79
212 0.77
213 0.73
214 0.64
215 0.56
216 0.48
217 0.39
218 0.35
219 0.33
220 0.33
221 0.36
222 0.43
223 0.46
224 0.5
225 0.55
226 0.58
227 0.59
228 0.51
229 0.49
230 0.47
231 0.43
232 0.42
233 0.39
234 0.35
235 0.37
236 0.39