Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L7XIN0

Protein Details
Accession A0A1L7XIN0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPVGKHKRKPKDAKSFKKKLDEKAQAGBasic
NLS Segment(s)
PositionSequence
5-20KHKRKPKDAKSFKKKL
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MPVGKHKRKPKDAKSFKKKLDEKAQAGDYKGIPPLVQEDLEVGGSADYYNKPGPLSLTNEIEYLVFIIYGGFTIGNSSKVYMGNGVGHYVNGESVLTLEQQTALVIIAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.93
3 0.9
4 0.9
5 0.85
6 0.83
7 0.83
8 0.81
9 0.74
10 0.7
11 0.68
12 0.6
13 0.55
14 0.48
15 0.38
16 0.3
17 0.27
18 0.2
19 0.15
20 0.13
21 0.14
22 0.13
23 0.12
24 0.1
25 0.09
26 0.1
27 0.1
28 0.09
29 0.07
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.1
41 0.11
42 0.16
43 0.16
44 0.18
45 0.18
46 0.18
47 0.18
48 0.16
49 0.14
50 0.09
51 0.07
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.05
61 0.05
62 0.07
63 0.07
64 0.08
65 0.09
66 0.1
67 0.11
68 0.1
69 0.11
70 0.12
71 0.12
72 0.14
73 0.12
74 0.12
75 0.12
76 0.11
77 0.09
78 0.07
79 0.07
80 0.05
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06