Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L7WGX2

Protein Details
Accession A0A1L7WGX2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-72IWQFTFKPRRTKIWRVRNVRKGSRGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045518  2EXR  
Pfam View protein in Pfam  
PF20150  2EXR  
Amino Acid Sequences MDSASVTVAVVRNELSDPGIILYLQPLPEFNTFTCFSDLPIELRLAIWQFTFKPRRTKIWRVRNVRKGSRGLWFTFDPAPLTLSIFQESRACALENYRILTYEPEFEQSFRYLNPEIDTLIFPNHTLLEVGEGFPWHFKSDDATSTYLLPKYLDTGDYLGMERTFSKGMEAGRLTKVKKLYLGRNYTEQQYKEIEKALRGVYEKMATKISGLDAPEIIFMRKTLKYPSWRDRIVRTQVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.1
5 0.1
6 0.11
7 0.09
8 0.08
9 0.09
10 0.1
11 0.11
12 0.1
13 0.1
14 0.13
15 0.16
16 0.18
17 0.16
18 0.19
19 0.21
20 0.23
21 0.25
22 0.22
23 0.21
24 0.23
25 0.24
26 0.2
27 0.2
28 0.18
29 0.15
30 0.15
31 0.16
32 0.12
33 0.12
34 0.1
35 0.11
36 0.12
37 0.22
38 0.29
39 0.32
40 0.41
41 0.45
42 0.55
43 0.61
44 0.71
45 0.72
46 0.76
47 0.81
48 0.82
49 0.88
50 0.87
51 0.88
52 0.85
53 0.81
54 0.74
55 0.67
56 0.64
57 0.57
58 0.49
59 0.44
60 0.37
61 0.33
62 0.3
63 0.27
64 0.21
65 0.17
66 0.17
67 0.12
68 0.13
69 0.12
70 0.12
71 0.13
72 0.12
73 0.12
74 0.13
75 0.13
76 0.12
77 0.11
78 0.11
79 0.09
80 0.11
81 0.15
82 0.15
83 0.17
84 0.16
85 0.15
86 0.15
87 0.16
88 0.16
89 0.13
90 0.12
91 0.13
92 0.13
93 0.13
94 0.14
95 0.13
96 0.13
97 0.11
98 0.14
99 0.12
100 0.12
101 0.13
102 0.12
103 0.11
104 0.12
105 0.12
106 0.09
107 0.09
108 0.08
109 0.07
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.07
118 0.06
119 0.07
120 0.07
121 0.07
122 0.08
123 0.07
124 0.07
125 0.07
126 0.1
127 0.12
128 0.14
129 0.16
130 0.16
131 0.16
132 0.17
133 0.19
134 0.16
135 0.15
136 0.12
137 0.1
138 0.11
139 0.11
140 0.1
141 0.09
142 0.1
143 0.1
144 0.11
145 0.11
146 0.1
147 0.09
148 0.09
149 0.08
150 0.09
151 0.09
152 0.08
153 0.09
154 0.11
155 0.11
156 0.16
157 0.17
158 0.18
159 0.22
160 0.27
161 0.27
162 0.29
163 0.31
164 0.28
165 0.33
166 0.36
167 0.41
168 0.46
169 0.52
170 0.5
171 0.54
172 0.55
173 0.54
174 0.54
175 0.46
176 0.4
177 0.38
178 0.37
179 0.32
180 0.36
181 0.32
182 0.27
183 0.29
184 0.28
185 0.27
186 0.26
187 0.26
188 0.24
189 0.28
190 0.28
191 0.26
192 0.27
193 0.23
194 0.22
195 0.22
196 0.2
197 0.18
198 0.17
199 0.16
200 0.15
201 0.15
202 0.17
203 0.16
204 0.15
205 0.13
206 0.12
207 0.16
208 0.18
209 0.2
210 0.24
211 0.32
212 0.4
213 0.5
214 0.59
215 0.63
216 0.67
217 0.7
218 0.71
219 0.73