Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L7XF55

Protein Details
Accession A0A1L7XF55    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-154DTYRPRSLSRSRSPRRHRTRSRSLSSRSRSPPRRRGGGRRDSPGRNSGRRRRSPSYBasic
160-179YDDRDRSRSRSRGRGGRGRRBasic
NLS Segment(s)
PositionSequence
102-151RPRSLSRSRSPRRHRTRSRSLSSRSRSPPRRRGGGRRDSPGRNSGRRRRS
165-179RSRSRSRGRGGRGRR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MPMNRSFNFNRGTAYILYTSEADAEAAIAHMHESQIDGAVINVSIVLPRRKFSPSPPTARRGANIDPRVPLSATFRPPPQSTRRRTPPPSYGRAERNFDTYRPRSLSRSRSPRRHRTRSRSLSSRSRSPPRRRGGGRRDSPGRNSGRRRRSPSYSSYSSYDDRDRSRSRSRGRGGRGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.19
4 0.2
5 0.17
6 0.16
7 0.13
8 0.12
9 0.09
10 0.08
11 0.07
12 0.05
13 0.05
14 0.05
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.07
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.05
30 0.04
31 0.05
32 0.08
33 0.14
34 0.14
35 0.15
36 0.18
37 0.23
38 0.24
39 0.3
40 0.38
41 0.41
42 0.49
43 0.54
44 0.55
45 0.55
46 0.55
47 0.5
48 0.44
49 0.43
50 0.42
51 0.41
52 0.39
53 0.35
54 0.35
55 0.35
56 0.3
57 0.24
58 0.2
59 0.21
60 0.23
61 0.24
62 0.24
63 0.27
64 0.28
65 0.32
66 0.36
67 0.4
68 0.44
69 0.51
70 0.58
71 0.63
72 0.67
73 0.68
74 0.68
75 0.66
76 0.66
77 0.61
78 0.57
79 0.56
80 0.54
81 0.52
82 0.43
83 0.43
84 0.38
85 0.35
86 0.38
87 0.33
88 0.33
89 0.33
90 0.34
91 0.33
92 0.39
93 0.46
94 0.47
95 0.57
96 0.61
97 0.68
98 0.75
99 0.81
100 0.85
101 0.87
102 0.88
103 0.86
104 0.89
105 0.88
106 0.87
107 0.84
108 0.81
109 0.8
110 0.75
111 0.75
112 0.72
113 0.72
114 0.74
115 0.76
116 0.79
117 0.76
118 0.8
119 0.79
120 0.81
121 0.81
122 0.82
123 0.78
124 0.77
125 0.78
126 0.73
127 0.69
128 0.67
129 0.65
130 0.63
131 0.67
132 0.68
133 0.71
134 0.76
135 0.8
136 0.79
137 0.8
138 0.77
139 0.75
140 0.73
141 0.68
142 0.62
143 0.57
144 0.55
145 0.49
146 0.47
147 0.45
148 0.42
149 0.41
150 0.45
151 0.47
152 0.49
153 0.57
154 0.62
155 0.64
156 0.69
157 0.74
158 0.75
159 0.79