Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L7X1E2

Protein Details
Accession A0A1L7X1E2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-60DASTSEPAKKRRKVEKTNLNLPPSRHydrophilic
NLS Segment(s)
PositionSequence
45-47KRR
Subcellular Location(s) nucl 18.5, mito_nucl 11, cyto 4, mito 2.5
Family & Domain DBs
Amino Acid Sequences MADKNTFERRRLDNIKRNGALLKNLGVNQQAQVIHDASTSEPAKKRRKVEKTNLNLPPSRTSARLASTPSKPTYNEDSLAAAVVESNAMPKSKYSKQRTSAKVTKFEEDTDTKPEMPTKDLAELQASWSSWEPVAPPPTRNEEGTFHFPSHPDFTPNKSPEEVLREGCFGGSYFRPLYSKKLGITISNDYLELPPSWTTNLNTSSYLTSPAYNPEINKFKVACGQSIEQWEEAGWINHDFDVRGWFQWYCRFFMGRRCEDDERQVSRWKKCVGKTGRWRRMLLKKYVAAGVGEVWDDGEEDQEEVSPVMHQTCHHWAFCVTQDVLDEYWRTGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.73
4 0.7
5 0.66
6 0.59
7 0.53
8 0.47
9 0.4
10 0.35
11 0.34
12 0.35
13 0.31
14 0.28
15 0.24
16 0.26
17 0.22
18 0.19
19 0.21
20 0.19
21 0.17
22 0.17
23 0.17
24 0.12
25 0.19
26 0.19
27 0.23
28 0.28
29 0.37
30 0.46
31 0.53
32 0.62
33 0.66
34 0.75
35 0.8
36 0.85
37 0.87
38 0.86
39 0.89
40 0.87
41 0.82
42 0.75
43 0.67
44 0.61
45 0.55
46 0.48
47 0.4
48 0.35
49 0.33
50 0.32
51 0.32
52 0.33
53 0.34
54 0.37
55 0.41
56 0.41
57 0.4
58 0.38
59 0.4
60 0.43
61 0.4
62 0.36
63 0.31
64 0.3
65 0.27
66 0.25
67 0.2
68 0.12
69 0.08
70 0.06
71 0.06
72 0.04
73 0.05
74 0.06
75 0.06
76 0.07
77 0.09
78 0.15
79 0.23
80 0.34
81 0.41
82 0.49
83 0.58
84 0.67
85 0.72
86 0.76
87 0.76
88 0.72
89 0.72
90 0.66
91 0.61
92 0.53
93 0.48
94 0.43
95 0.38
96 0.34
97 0.3
98 0.29
99 0.26
100 0.25
101 0.27
102 0.23
103 0.22
104 0.22
105 0.19
106 0.2
107 0.2
108 0.2
109 0.18
110 0.17
111 0.16
112 0.16
113 0.14
114 0.12
115 0.12
116 0.12
117 0.1
118 0.1
119 0.1
120 0.12
121 0.18
122 0.19
123 0.2
124 0.21
125 0.28
126 0.3
127 0.29
128 0.28
129 0.24
130 0.28
131 0.33
132 0.32
133 0.26
134 0.25
135 0.25
136 0.24
137 0.26
138 0.21
139 0.2
140 0.2
141 0.24
142 0.32
143 0.33
144 0.33
145 0.29
146 0.29
147 0.26
148 0.31
149 0.28
150 0.2
151 0.2
152 0.18
153 0.18
154 0.17
155 0.15
156 0.09
157 0.09
158 0.07
159 0.09
160 0.09
161 0.1
162 0.11
163 0.12
164 0.17
165 0.2
166 0.22
167 0.2
168 0.24
169 0.24
170 0.24
171 0.27
172 0.26
173 0.23
174 0.21
175 0.2
176 0.17
177 0.16
178 0.16
179 0.12
180 0.1
181 0.08
182 0.09
183 0.1
184 0.11
185 0.12
186 0.15
187 0.17
188 0.17
189 0.17
190 0.18
191 0.18
192 0.17
193 0.19
194 0.15
195 0.13
196 0.13
197 0.15
198 0.17
199 0.17
200 0.17
201 0.2
202 0.26
203 0.26
204 0.29
205 0.26
206 0.24
207 0.29
208 0.29
209 0.25
210 0.23
211 0.24
212 0.23
213 0.26
214 0.27
215 0.2
216 0.19
217 0.17
218 0.15
219 0.15
220 0.12
221 0.1
222 0.09
223 0.1
224 0.1
225 0.11
226 0.09
227 0.09
228 0.13
229 0.12
230 0.12
231 0.14
232 0.14
233 0.15
234 0.22
235 0.24
236 0.23
237 0.24
238 0.26
239 0.26
240 0.34
241 0.42
242 0.4
243 0.44
244 0.47
245 0.5
246 0.51
247 0.58
248 0.57
249 0.53
250 0.5
251 0.54
252 0.54
253 0.54
254 0.58
255 0.56
256 0.55
257 0.55
258 0.62
259 0.62
260 0.65
261 0.71
262 0.76
263 0.79
264 0.77
265 0.76
266 0.75
267 0.77
268 0.75
269 0.72
270 0.69
271 0.63
272 0.6
273 0.59
274 0.51
275 0.4
276 0.33
277 0.25
278 0.17
279 0.13
280 0.1
281 0.08
282 0.07
283 0.08
284 0.07
285 0.08
286 0.07
287 0.07
288 0.07
289 0.08
290 0.08
291 0.08
292 0.08
293 0.08
294 0.08
295 0.1
296 0.11
297 0.11
298 0.16
299 0.26
300 0.3
301 0.29
302 0.3
303 0.3
304 0.32
305 0.35
306 0.36
307 0.27
308 0.24
309 0.25
310 0.26
311 0.25
312 0.24
313 0.21