Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L7X2E5

Protein Details
Accession A0A1L7X2E5   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
142-170SKVLKPYPYPKPKKEKTPKKSQAKSKSGDHydrophilic
NLS Segment(s)
PositionSequence
129-168IKPPPKPKSTTPKSKVLKPYPYPKPKKEKTPKKSQAKSKS
Subcellular Location(s) cyto 20.5, cyto_mito 11.833, mito_nucl 2.833, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MATLRPQEVELLIAITKQISGNFDFTNAAQELGITTSAASQRWGRLKTKIIGKQEILLKSGDEHTLLVNIAKQFGAGHVNFEVVGAQIGTSAGAATQRWGRLRTKIMGGKGKAAAAMVDSLKNPDYKVIKPPPKPKSTTPKSKVLKPYPYPKPKKEKTPKKSQAKSKSGDPKEEENLDDLAEAQLHEKRASAVEQGYEADEAMYEYADAQAEEXXXXXXXLHWHLIKTPKFDSTPMTRPDRQTSKSLHLLMIGLSLLELDLEACAWSNLSVEHRRGTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.1
6 0.12
7 0.14
8 0.17
9 0.17
10 0.19
11 0.19
12 0.18
13 0.22
14 0.19
15 0.17
16 0.13
17 0.13
18 0.12
19 0.12
20 0.12
21 0.07
22 0.06
23 0.09
24 0.11
25 0.11
26 0.13
27 0.14
28 0.2
29 0.28
30 0.32
31 0.32
32 0.37
33 0.43
34 0.48
35 0.56
36 0.57
37 0.57
38 0.58
39 0.56
40 0.56
41 0.55
42 0.5
43 0.41
44 0.34
45 0.27
46 0.23
47 0.24
48 0.19
49 0.13
50 0.12
51 0.11
52 0.11
53 0.11
54 0.1
55 0.11
56 0.1
57 0.1
58 0.1
59 0.1
60 0.08
61 0.1
62 0.14
63 0.11
64 0.13
65 0.13
66 0.13
67 0.13
68 0.13
69 0.11
70 0.06
71 0.06
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.06
83 0.08
84 0.11
85 0.13
86 0.17
87 0.19
88 0.23
89 0.28
90 0.29
91 0.34
92 0.35
93 0.38
94 0.42
95 0.41
96 0.39
97 0.36
98 0.33
99 0.26
100 0.22
101 0.16
102 0.1
103 0.1
104 0.07
105 0.07
106 0.07
107 0.08
108 0.09
109 0.09
110 0.09
111 0.12
112 0.15
113 0.15
114 0.24
115 0.32
116 0.39
117 0.46
118 0.56
119 0.59
120 0.62
121 0.65
122 0.64
123 0.65
124 0.65
125 0.69
126 0.64
127 0.67
128 0.64
129 0.67
130 0.69
131 0.66
132 0.66
133 0.61
134 0.66
135 0.66
136 0.74
137 0.74
138 0.73
139 0.76
140 0.73
141 0.79
142 0.8
143 0.81
144 0.79
145 0.83
146 0.85
147 0.85
148 0.88
149 0.87
150 0.86
151 0.83
152 0.78
153 0.75
154 0.76
155 0.68
156 0.66
157 0.59
158 0.53
159 0.5
160 0.48
161 0.39
162 0.31
163 0.28
164 0.21
165 0.17
166 0.13
167 0.09
168 0.07
169 0.07
170 0.07
171 0.09
172 0.1
173 0.1
174 0.1
175 0.11
176 0.12
177 0.13
178 0.14
179 0.13
180 0.12
181 0.13
182 0.13
183 0.13
184 0.12
185 0.1
186 0.08
187 0.06
188 0.06
189 0.05
190 0.05
191 0.04
192 0.04
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.07
201 0.08
202 0.08
203 0.09
204 0.12
205 0.19
206 0.21
207 0.25
208 0.27
209 0.3
210 0.32
211 0.33
212 0.36
213 0.36
214 0.42
215 0.43
216 0.49
217 0.49
218 0.52
219 0.6
220 0.63
221 0.58
222 0.57
223 0.56
224 0.56
225 0.58
226 0.55
227 0.46
228 0.39
229 0.36
230 0.3
231 0.25
232 0.17
233 0.09
234 0.07
235 0.06
236 0.05
237 0.04
238 0.04
239 0.03
240 0.03
241 0.03
242 0.04
243 0.04
244 0.05
245 0.05
246 0.06
247 0.06
248 0.08
249 0.15
250 0.21
251 0.24