Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VSH4

Protein Details
Accession A0A1M2VSH4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89LINGFRRGVSPKRRHNPKFRBasic
NLS Segment(s)
PositionSequence
78-89VSPKRRHNPKFR
Subcellular Location(s) cyto 12.5, mito 9, cyto_nucl 8, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002466  A_deamin  
Gene Ontology GO:0004000  F:adenosine deaminase activity  
GO:0003723  F:RNA binding  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF02137  A_deamin  
PROSITE View protein in PROSITE  
PS50141  A_DEAMIN_EDITASE  
Amino Acid Sequences MSCSDKIAAWNVLGIQGALGSRLLQPVYISRIIIGEVAAAMHDEVTIDCARALYGRLRSINGSLRESEVLINGFRRGVSPKRRHNPKFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.08
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.06
9 0.08
10 0.08
11 0.07
12 0.08
13 0.1
14 0.14
15 0.14
16 0.13
17 0.12
18 0.12
19 0.12
20 0.12
21 0.09
22 0.05
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.02
30 0.03
31 0.03
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.07
40 0.09
41 0.12
42 0.16
43 0.17
44 0.18
45 0.19
46 0.22
47 0.28
48 0.27
49 0.26
50 0.24
51 0.25
52 0.24
53 0.24
54 0.21
55 0.16
56 0.14
57 0.13
58 0.13
59 0.12
60 0.12
61 0.11
62 0.13
63 0.17
64 0.25
65 0.35
66 0.43
67 0.54
68 0.64
69 0.75