Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VDI9

Protein Details
Accession A0A1M2VDI9   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
173-194GWKTSGSHKRGKGKYRDDSCEGBasic
NLS Segment(s)
Subcellular Location(s) mito 6.5, nucl 6, pero 6, cyto_mito 6, cyto 4.5, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MAAVNAAAPALSSRAGDTPQATFPPPAVPQPSYIMPGCFAFATTQQIAPAVLPILPTPAVPDLPFRELDKLWDLKVVYTPPSMRPWPAGIFAQDMARALLFIGDTDSEGTLQGPKTLAARFEYVFQGRPFKSVTYQAQHVVWVNSTQEQCKWIMTRPRTRDGLWTECRKQLTGWKTSGSHKRGKGKYRDDSCEGSEPDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.17
6 0.19
7 0.21
8 0.22
9 0.2
10 0.2
11 0.23
12 0.23
13 0.25
14 0.26
15 0.25
16 0.26
17 0.29
18 0.3
19 0.29
20 0.28
21 0.24
22 0.2
23 0.2
24 0.18
25 0.14
26 0.13
27 0.1
28 0.11
29 0.16
30 0.15
31 0.15
32 0.15
33 0.15
34 0.14
35 0.13
36 0.12
37 0.07
38 0.06
39 0.06
40 0.06
41 0.08
42 0.08
43 0.07
44 0.09
45 0.09
46 0.1
47 0.1
48 0.13
49 0.14
50 0.16
51 0.17
52 0.17
53 0.19
54 0.18
55 0.2
56 0.22
57 0.2
58 0.18
59 0.2
60 0.19
61 0.16
62 0.19
63 0.18
64 0.14
65 0.15
66 0.16
67 0.16
68 0.21
69 0.21
70 0.19
71 0.2
72 0.21
73 0.2
74 0.2
75 0.19
76 0.15
77 0.15
78 0.15
79 0.13
80 0.11
81 0.1
82 0.08
83 0.07
84 0.06
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.09
103 0.09
104 0.1
105 0.11
106 0.13
107 0.12
108 0.14
109 0.17
110 0.16
111 0.19
112 0.18
113 0.23
114 0.21
115 0.23
116 0.22
117 0.2
118 0.22
119 0.25
120 0.29
121 0.27
122 0.29
123 0.3
124 0.29
125 0.29
126 0.28
127 0.22
128 0.17
129 0.14
130 0.13
131 0.16
132 0.17
133 0.17
134 0.16
135 0.17
136 0.17
137 0.19
138 0.2
139 0.22
140 0.31
141 0.38
142 0.47
143 0.52
144 0.58
145 0.58
146 0.58
147 0.59
148 0.56
149 0.57
150 0.55
151 0.58
152 0.55
153 0.56
154 0.57
155 0.49
156 0.45
157 0.44
158 0.43
159 0.41
160 0.4
161 0.4
162 0.41
163 0.49
164 0.57
165 0.54
166 0.56
167 0.57
168 0.64
169 0.68
170 0.75
171 0.77
172 0.77
173 0.82
174 0.82
175 0.81
176 0.76
177 0.72
178 0.68
179 0.65
180 0.57