Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VSQ2

Protein Details
Accession A0A1M2VSQ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-48FWDKWNKGKQWKDIRDKYQEEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 5, plas 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MSVSVFVPTIFVGAFAFSIGFDVGITGFWDKWNKGKQWKDIRDKYQEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.05
6 0.04
7 0.04
8 0.03
9 0.04
10 0.03
11 0.04
12 0.04
13 0.04
14 0.05
15 0.06
16 0.09
17 0.1
18 0.17
19 0.23
20 0.29
21 0.38
22 0.45
23 0.54
24 0.63
25 0.72
26 0.77
27 0.8
28 0.82
29 0.82