Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VLP3

Protein Details
Accession A0A1M2VLP3    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSGERPCKRTRREDIPPNVVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 9.5, cyto 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
PROSITE View protein in PROSITE  
PS50097  BTB  
Amino Acid Sequences MSGERPCKRTRREDIPPNVVAAVDCRAESITATDALAKPGPTRDKDVWLSTGNLIIVASGRVAFRIFRGLLAIKSEVFRGLFELPPPPDHEKMDGCPVVELSDSPDDLKHLFLVMYYRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.74
4 0.65
5 0.56
6 0.46
7 0.35
8 0.26
9 0.19
10 0.12
11 0.11
12 0.1
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.09
19 0.09
20 0.11
21 0.11
22 0.12
23 0.13
24 0.12
25 0.11
26 0.16
27 0.21
28 0.21
29 0.27
30 0.27
31 0.31
32 0.34
33 0.35
34 0.32
35 0.29
36 0.28
37 0.22
38 0.21
39 0.15
40 0.12
41 0.1
42 0.07
43 0.06
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.08
53 0.08
54 0.08
55 0.1
56 0.11
57 0.11
58 0.13
59 0.13
60 0.11
61 0.11
62 0.11
63 0.11
64 0.1
65 0.09
66 0.1
67 0.11
68 0.11
69 0.12
70 0.16
71 0.16
72 0.17
73 0.22
74 0.25
75 0.26
76 0.26
77 0.29
78 0.27
79 0.29
80 0.35
81 0.31
82 0.26
83 0.24
84 0.23
85 0.2
86 0.18
87 0.15
88 0.12
89 0.14
90 0.14
91 0.14
92 0.14
93 0.15
94 0.15
95 0.16
96 0.12
97 0.1
98 0.1
99 0.1
100 0.16