Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8Y1I6

Protein Details
Accession G8Y1I6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
144-166SDLVSWKKAAKKLKIRRFSNESSHydrophilic
NLS Segment(s)
PositionSequence
151-158KAAKKLKI
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences MCVCREEVYRARDMIYELLEDSYREYIRSVRGRRSSSVVPSARRVSDAVPPDALWGGSAAGAAAGASRTLSPTPPAELGAKPVANASACGSSYSLTSPISVSQAITSSDEDLEKLERQRENSAGTMTSSRASSISSIMDSFKNSDLVSWKKAAKKLKIRRFSNESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.23
3 0.19
4 0.15
5 0.16
6 0.15
7 0.14
8 0.14
9 0.16
10 0.14
11 0.14
12 0.14
13 0.16
14 0.24
15 0.33
16 0.36
17 0.41
18 0.49
19 0.52
20 0.54
21 0.57
22 0.53
23 0.49
24 0.54
25 0.49
26 0.45
27 0.46
28 0.47
29 0.42
30 0.38
31 0.34
32 0.26
33 0.28
34 0.29
35 0.25
36 0.22
37 0.21
38 0.21
39 0.2
40 0.18
41 0.11
42 0.07
43 0.06
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.03
54 0.03
55 0.04
56 0.05
57 0.06
58 0.07
59 0.08
60 0.1
61 0.1
62 0.12
63 0.12
64 0.12
65 0.14
66 0.15
67 0.14
68 0.13
69 0.12
70 0.12
71 0.1
72 0.1
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.07
85 0.08
86 0.09
87 0.08
88 0.08
89 0.07
90 0.08
91 0.09
92 0.1
93 0.1
94 0.09
95 0.1
96 0.1
97 0.09
98 0.09
99 0.11
100 0.12
101 0.14
102 0.19
103 0.2
104 0.23
105 0.26
106 0.28
107 0.29
108 0.28
109 0.27
110 0.22
111 0.21
112 0.2
113 0.17
114 0.16
115 0.13
116 0.12
117 0.11
118 0.11
119 0.1
120 0.11
121 0.11
122 0.11
123 0.11
124 0.13
125 0.14
126 0.14
127 0.16
128 0.16
129 0.16
130 0.15
131 0.17
132 0.22
133 0.26
134 0.28
135 0.3
136 0.34
137 0.39
138 0.45
139 0.52
140 0.56
141 0.62
142 0.69
143 0.75
144 0.8
145 0.8
146 0.84