Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QW25

Protein Details
Accession C4QW25    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
172-195LARAERKKLVKKYELQQKKNLKAQHydrophilic
NLS Segment(s)
PositionSequence
108-115KFAAKKGI
175-199AERKKLVKKYELQQKKNLKAQGKGK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.833, mito_nucl 11.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0005840  C:ribosome  
GO:0042254  P:ribosome biogenesis  
KEGG ppa:PAS_chr1-1_0088  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSGKSATVDKPIPVAYDLGNLAVFDSNPLESNKLSDASQVNEYLEQVTRDNTQLLINQILSQPVRNTTDSVSEGQEASIALITLPDPSTPLPREKSVPKPREMTRWEKFAAKKGIQAKGKTGKMIYDEESGEWVPKWGYKGNNKQLDNQWLVEMNEKTEEKDKDTLIDPRTLARAERKKLVKKYELQQKKNLKAQGKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.17
3 0.18
4 0.17
5 0.15
6 0.14
7 0.12
8 0.12
9 0.11
10 0.1
11 0.08
12 0.09
13 0.09
14 0.11
15 0.12
16 0.13
17 0.12
18 0.15
19 0.15
20 0.16
21 0.15
22 0.18
23 0.19
24 0.19
25 0.22
26 0.21
27 0.2
28 0.18
29 0.19
30 0.16
31 0.15
32 0.14
33 0.12
34 0.13
35 0.14
36 0.14
37 0.14
38 0.13
39 0.13
40 0.14
41 0.15
42 0.15
43 0.14
44 0.14
45 0.14
46 0.16
47 0.15
48 0.14
49 0.13
50 0.15
51 0.18
52 0.17
53 0.18
54 0.16
55 0.2
56 0.2
57 0.21
58 0.18
59 0.16
60 0.15
61 0.14
62 0.13
63 0.09
64 0.08
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.04
73 0.05
74 0.06
75 0.1
76 0.12
77 0.16
78 0.17
79 0.19
80 0.22
81 0.26
82 0.37
83 0.43
84 0.46
85 0.46
86 0.49
87 0.5
88 0.55
89 0.55
90 0.53
91 0.46
92 0.46
93 0.43
94 0.43
95 0.43
96 0.42
97 0.44
98 0.36
99 0.38
100 0.4
101 0.46
102 0.45
103 0.44
104 0.43
105 0.44
106 0.45
107 0.41
108 0.35
109 0.3
110 0.28
111 0.29
112 0.25
113 0.19
114 0.19
115 0.17
116 0.19
117 0.17
118 0.15
119 0.12
120 0.11
121 0.08
122 0.09
123 0.12
124 0.14
125 0.21
126 0.3
127 0.4
128 0.49
129 0.58
130 0.58
131 0.62
132 0.63
133 0.64
134 0.57
135 0.48
136 0.39
137 0.33
138 0.32
139 0.32
140 0.26
141 0.2
142 0.22
143 0.21
144 0.22
145 0.27
146 0.28
147 0.26
148 0.3
149 0.29
150 0.27
151 0.3
152 0.35
153 0.31
154 0.33
155 0.29
156 0.28
157 0.3
158 0.29
159 0.28
160 0.32
161 0.39
162 0.39
163 0.48
164 0.55
165 0.62
166 0.69
167 0.75
168 0.74
169 0.73
170 0.77
171 0.8
172 0.81
173 0.78
174 0.79
175 0.8
176 0.8
177 0.8
178 0.78
179 0.74