Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VE77

Protein Details
Accession A0A1M2VE77   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-35IGYGISARARPRRQRTRHRARRVGIKLDHydrophilic
NLS Segment(s)
PositionSequence
15-30RARPRRQRTRHRARRV
Subcellular Location(s) nucl 11, mito 8, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MADAADAIGYGISARARPRRQRTRHRARRVGIKLDLAVYNESDELDLAVQNDAWPTSDDLTGSGPDSVSRPSIFAGDNAGYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.22
3 0.31
4 0.41
5 0.52
6 0.62
7 0.72
8 0.81
9 0.87
10 0.89
11 0.92
12 0.93
13 0.91
14 0.85
15 0.86
16 0.81
17 0.76
18 0.67
19 0.57
20 0.47
21 0.4
22 0.35
23 0.26
24 0.2
25 0.13
26 0.11
27 0.09
28 0.08
29 0.07
30 0.06
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.09
44 0.09
45 0.09
46 0.1
47 0.11
48 0.11
49 0.11
50 0.1
51 0.08
52 0.09
53 0.1
54 0.11
55 0.12
56 0.12
57 0.12
58 0.12
59 0.15
60 0.15
61 0.14
62 0.17