Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VPL8

Protein Details
Accession A0A1M2VPL8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-49KPPVVYPRKTVPRRYSERKTYLYHydrophilic
196-217AAFVPGRRPKRQRPTPVPDLKLHydrophilic
NLS Segment(s)
PositionSequence
202-206RRPKR
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
Amino Acid Sequences MLGSTSRLLPSPRPMLVQTRAYAVSLKPPVVYPRKTVPRRYSERKTYLYNQYTRLLQSSFDRPLILFEHADFSASRLIRLRADIADAVAKHAKVSAPTLAAATLVPASAPAQDVPPTLTILRTSLFGVALRDLSVLDTPLRRQLAKTVPGTLAALSFPTLNPPQLKAVLRVLARSVPPRKPKTQQAVDDERKAAEAAFVPGRRPKRQRPTPVPDLKLLGALIEGRLYKTEGVQSVAELPTLDGLRAQIVGLLSAPAAQLSMVLGEASGGKLARTLEGFKKSLEPETQEGEAPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.46
4 0.47
5 0.4
6 0.38
7 0.37
8 0.34
9 0.34
10 0.27
11 0.29
12 0.27
13 0.27
14 0.23
15 0.25
16 0.33
17 0.39
18 0.42
19 0.38
20 0.45
21 0.55
22 0.61
23 0.69
24 0.69
25 0.71
26 0.78
27 0.82
28 0.82
29 0.82
30 0.83
31 0.78
32 0.76
33 0.73
34 0.74
35 0.73
36 0.67
37 0.6
38 0.56
39 0.53
40 0.47
41 0.42
42 0.32
43 0.26
44 0.26
45 0.28
46 0.28
47 0.26
48 0.25
49 0.22
50 0.24
51 0.25
52 0.23
53 0.17
54 0.14
55 0.17
56 0.16
57 0.17
58 0.14
59 0.13
60 0.17
61 0.16
62 0.17
63 0.16
64 0.18
65 0.18
66 0.2
67 0.21
68 0.15
69 0.17
70 0.16
71 0.14
72 0.15
73 0.14
74 0.16
75 0.16
76 0.15
77 0.13
78 0.14
79 0.14
80 0.12
81 0.14
82 0.13
83 0.12
84 0.12
85 0.13
86 0.11
87 0.11
88 0.09
89 0.08
90 0.06
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.06
99 0.07
100 0.08
101 0.09
102 0.09
103 0.1
104 0.09
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.08
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.11
127 0.13
128 0.12
129 0.12
130 0.18
131 0.23
132 0.27
133 0.28
134 0.26
135 0.25
136 0.25
137 0.25
138 0.19
139 0.14
140 0.08
141 0.07
142 0.05
143 0.05
144 0.05
145 0.08
146 0.08
147 0.1
148 0.11
149 0.12
150 0.13
151 0.17
152 0.18
153 0.18
154 0.19
155 0.21
156 0.21
157 0.2
158 0.19
159 0.18
160 0.18
161 0.23
162 0.27
163 0.3
164 0.39
165 0.44
166 0.49
167 0.53
168 0.6
169 0.63
170 0.66
171 0.66
172 0.64
173 0.69
174 0.68
175 0.65
176 0.56
177 0.46
178 0.39
179 0.32
180 0.24
181 0.14
182 0.11
183 0.1
184 0.14
185 0.14
186 0.16
187 0.22
188 0.28
189 0.35
190 0.41
191 0.49
192 0.56
193 0.65
194 0.74
195 0.79
196 0.82
197 0.85
198 0.86
199 0.79
200 0.7
201 0.63
202 0.52
203 0.43
204 0.34
205 0.23
206 0.14
207 0.11
208 0.09
209 0.08
210 0.08
211 0.07
212 0.08
213 0.1
214 0.09
215 0.11
216 0.14
217 0.13
218 0.16
219 0.15
220 0.15
221 0.17
222 0.17
223 0.16
224 0.13
225 0.11
226 0.12
227 0.12
228 0.11
229 0.08
230 0.09
231 0.09
232 0.09
233 0.09
234 0.08
235 0.07
236 0.08
237 0.07
238 0.07
239 0.06
240 0.07
241 0.07
242 0.05
243 0.05
244 0.04
245 0.04
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.05
253 0.05
254 0.07
255 0.06
256 0.06
257 0.08
258 0.09
259 0.11
260 0.13
261 0.18
262 0.24
263 0.31
264 0.32
265 0.31
266 0.37
267 0.37
268 0.41
269 0.41
270 0.39
271 0.36
272 0.4
273 0.4
274 0.36