FuNGI

A0A1M2V782

Protein Details

Accession

A0A1M2V782

Localization Confidence

Medium

Confidence Score

14.4

NoLS Segment(s)

Position	Sequence	Protein Nature
45-70	IDEAIRLEDKQRKKRKIVRLLLLGQS	Hydrophilic

NLS Segment(s)

Position	Sequence
56-60	RKKRK

Subcellular Location(s)

nucl 24.5, cyto_nucl 14

Family & Domain DBs

InterPro	View protein in InterPro IPR001019 Gprotein_alpha_su IPR011025 GproteinA_insert IPR027417 P-loop_NTPase
Gene Ontology	GO:0031683 F:G-protein beta/gamma-subunit complex binding GO:0005525 F:GTP binding GO:0003924 F:GTPase activity GO:0007186 P:G protein-coupled receptor signaling pathway
Pfam	View protein in Pfam PF00503 G-alpha
PROSITE	View protein in PROSITE PS51882 G_ALPHA

Amino Acid Sequences

MPVSREPTDRDPLSAALRPPIDETEEEKAHRLADEEAAKRVSLAIDEAIRLEDKQRKKRKIVRLLLLGQSESGKSTTLRQFQRLYTPNAFREERVLWRAVIQLNIVRSIHTILDALSDIRRRDVYPSSIYTSEPDSDSESEHQVSLPYHLDDLRRRLYPLRHVESLLIAKLVPPNEHEATTLGVGGSNSVNGNVSYYGSGYSQPSHAFHNQEVFVRPGASWKLRTSGRPQSAGTTGQETIDESQTVLHHCRADIGTLWEDPVTRQILRRRKIRLEESPGFYLNDLDRVTSLSYFPSDDDVLRARLKTVGVSEYSFHMEAGPESGTEWRIIDSTNQRPTWVPFFDDVNAIIFLAPISAFDQTLVEDRSINRLEDSVLLWKEVCSNKLLAKVDLVLFLNKCDILTSKLKSGVRLAKYVRSFADRPNEPEVVEKLKDMVIREHLRASKLL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.39
2	0.35
3	0.32
4	0.32
5	0.31
6	0.31
7	0.3
8	0.28
9	0.26
10	0.29
11	0.3
12	0.33
13	0.33
14	0.33
15	0.32
16	0.29
17	0.27
18	0.24
19	0.19
20	0.22
21	0.29
22	0.28
23	0.31
24	0.31
25	0.3
26	0.28
27	0.27
28	0.21
29	0.14
30	0.13
31	0.12
32	0.13
33	0.13
34	0.14
35	0.14
36	0.14
37	0.14
38	0.19
39	0.24
40	0.33
41	0.44
42	0.54
43	0.61
44	0.71
45	0.81
46	0.85
47	0.88
48	0.88
49	0.86
50	0.85
51	0.81
52	0.76
53	0.68
54	0.57
55	0.47
56	0.38
57	0.29
58	0.21
59	0.16
60	0.12
61	0.11
62	0.18
63	0.25
64	0.32
65	0.36
66	0.41
67	0.44
68	0.46
69	0.55
70	0.53
71	0.52
72	0.52
73	0.54
74	0.52
75	0.54
76	0.53
77	0.43
78	0.43
79	0.39
80	0.37
81	0.35
82	0.33
83	0.26
84	0.27
85	0.31
86	0.27
87	0.25
88	0.2
89	0.19
90	0.19
91	0.21
92	0.2
93	0.16
94	0.15
95	0.16
96	0.14
97	0.12
98	0.11
99	0.08
100	0.09
101	0.09
102	0.09
103	0.11
104	0.14
105	0.14
106	0.16
107	0.17
108	0.17
109	0.21
110	0.24
111	0.26
112	0.27
113	0.3
114	0.32
115	0.31
116	0.31
117	0.28
118	0.26
119	0.23
120	0.19
121	0.17
122	0.16
123	0.16
124	0.17
125	0.18
126	0.18
127	0.17
128	0.16
129	0.15
130	0.14
131	0.13
132	0.14
133	0.13
134	0.11
135	0.12
136	0.14
137	0.17
138	0.2
139	0.25
140	0.27
141	0.26
142	0.27
143	0.32
144	0.34
145	0.4
146	0.45
147	0.45
148	0.43
149	0.42
150	0.41
151	0.39
152	0.36
153	0.26
154	0.17
155	0.12
156	0.11
157	0.13
158	0.13
159	0.11
160	0.11
161	0.16
162	0.17
163	0.18
164	0.17
165	0.15
166	0.15
167	0.15
168	0.14
169	0.08
170	0.07
171	0.06
172	0.07
173	0.06
174	0.06
175	0.05
176	0.05
177	0.06
178	0.05
179	0.06
180	0.06
181	0.06
182	0.06
183	0.06
184	0.07
185	0.07
186	0.08
187	0.08
188	0.08
189	0.09
190	0.1
191	0.11
192	0.14
193	0.17
194	0.18
195	0.17
196	0.2
197	0.2
198	0.2
199	0.21
200	0.18
201	0.15
202	0.14
203	0.13
204	0.12
205	0.14
206	0.14
207	0.15
208	0.15
209	0.19
210	0.2
211	0.23
212	0.27
213	0.33
214	0.35
215	0.35
216	0.35
217	0.33
218	0.33
219	0.33
220	0.27
221	0.2
222	0.17
223	0.14
224	0.14
225	0.12
226	0.11
227	0.1
228	0.09
229	0.07
230	0.08
231	0.08
232	0.1
233	0.11
234	0.12
235	0.11
236	0.11
237	0.13
238	0.12
239	0.13
240	0.12
241	0.13
242	0.13
243	0.12
244	0.13
245	0.11
246	0.11
247	0.1
248	0.12
249	0.12
250	0.11
251	0.16
252	0.24
253	0.32
254	0.39
255	0.46
256	0.49
257	0.54
258	0.61
259	0.64
260	0.65
261	0.65
262	0.65
263	0.62
264	0.58
265	0.52
266	0.44
267	0.37
268	0.3
269	0.21
270	0.18
271	0.14
272	0.11
273	0.1
274	0.11
275	0.12
276	0.11
277	0.11
278	0.08
279	0.09
280	0.09
281	0.09
282	0.1
283	0.11
284	0.1
285	0.12
286	0.13
287	0.15
288	0.16
289	0.16
290	0.14
291	0.16
292	0.16
293	0.15
294	0.15
295	0.14
296	0.14
297	0.15
298	0.15
299	0.15
300	0.18
301	0.16
302	0.14
303	0.12
304	0.11
305	0.1
306	0.11
307	0.1
308	0.07
309	0.07
310	0.09
311	0.09
312	0.09
313	0.1
314	0.08
315	0.09
316	0.09
317	0.15
318	0.21
319	0.28
320	0.35
321	0.35
322	0.36
323	0.37
324	0.41
325	0.41
326	0.35
327	0.29
328	0.24
329	0.26
330	0.26
331	0.25
332	0.22
333	0.17
334	0.16
335	0.13
336	0.11
337	0.09
338	0.07
339	0.07
340	0.06
341	0.05
342	0.06
343	0.06
344	0.06
345	0.07
346	0.07
347	0.08
348	0.11
349	0.12
350	0.11
351	0.13
352	0.14
353	0.2
354	0.22
355	0.22
356	0.19
357	0.18
358	0.19
359	0.18
360	0.19
361	0.2
362	0.18
363	0.18
364	0.18
365	0.18
366	0.23
367	0.25
368	0.24
369	0.2
370	0.22
371	0.24
372	0.31
373	0.33
374	0.27
375	0.26
376	0.28
377	0.26
378	0.27
379	0.25
380	0.22
381	0.2
382	0.2
383	0.2
384	0.17
385	0.16
386	0.14
387	0.15
388	0.16
389	0.23
390	0.26
391	0.29
392	0.36
393	0.37
394	0.38
395	0.45
396	0.48
397	0.45
398	0.49
399	0.48
400	0.49
401	0.51
402	0.53
403	0.47
404	0.46
405	0.44
406	0.44
407	0.51
408	0.47
409	0.49
410	0.52
411	0.5
412	0.43
413	0.46
414	0.43
415	0.39
416	0.35
417	0.3
418	0.26
419	0.27
420	0.29
421	0.27
422	0.28
423	0.31
424	0.36
425	0.37
426	0.43
427	0.44

A0A1M2V782

3D AlphaFold-predicted Structure Viewer