Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2W364

Protein Details
Accession A0A1M2W364    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
2-41TQLAGGKDRKDRKDRKDRKDRKDRKDRKDRKDRKEHDMEQBasic
NLS Segment(s)
PositionSequence
7-35GKDRKDRKDRKDRKDRKDRKDRKDRKDRK
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MTQLAGGKDRKDRKDRKDRKDRKDRKDRKDRKDRKEHDMEQAVAEHPADPQRLREGEDEDRRVEDEDGAPCGSKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.87
4 0.9
5 0.91
6 0.92
7 0.94
8 0.94
9 0.93
10 0.94
11 0.94
12 0.93
13 0.94
14 0.94
15 0.93
16 0.94
17 0.93
18 0.92
19 0.93
20 0.87
21 0.84
22 0.84
23 0.75
24 0.71
25 0.65
26 0.55
27 0.44
28 0.4
29 0.31
30 0.22
31 0.19
32 0.11
33 0.08
34 0.1
35 0.11
36 0.11
37 0.12
38 0.17
39 0.18
40 0.2
41 0.22
42 0.25
43 0.32
44 0.39
45 0.41
46 0.37
47 0.37
48 0.36
49 0.35
50 0.31
51 0.24
52 0.2
53 0.19
54 0.21
55 0.2