Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VTN0

Protein Details
Accession A0A1M2VTN0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-32KRFLSLGSSKSRRNKKKQNASHGKDVDAHydrophilic
NLS Segment(s)
PositionSequence
15-21SRRNKKK
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MGFLKRFLSLGSSKSRRNKKKQNASHGKDVDAEGRILQQHELAPSDPDTSANKLLRSSSTKFSVMSEIDYTSLPPPPLPVGRFPSTPSLSPSPSMLTVATTPGVKRSGTYVVKVHSRTTHSRTEFPRANPPPSPTKQPRTAEPNTPHQDEYDTDEDDNPEDEPRAPRLKEVQFTPKDSSRIYALRRDPSVVSLLNMYDDNGCLDVHAFASSPPTPAPVSTETEGRQPRPRTGSTLRQLLGEPQPTFTEHTHEGDISWAERFLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.64
3 0.69
4 0.77
5 0.83
6 0.84
7 0.9
8 0.92
9 0.94
10 0.94
11 0.9
12 0.9
13 0.81
14 0.72
15 0.63
16 0.54
17 0.47
18 0.37
19 0.3
20 0.2
21 0.2
22 0.2
23 0.18
24 0.17
25 0.15
26 0.15
27 0.16
28 0.17
29 0.15
30 0.16
31 0.16
32 0.18
33 0.16
34 0.16
35 0.17
36 0.19
37 0.25
38 0.26
39 0.26
40 0.25
41 0.26
42 0.29
43 0.32
44 0.32
45 0.31
46 0.33
47 0.33
48 0.32
49 0.32
50 0.32
51 0.26
52 0.25
53 0.21
54 0.17
55 0.17
56 0.16
57 0.16
58 0.13
59 0.15
60 0.12
61 0.11
62 0.12
63 0.14
64 0.18
65 0.18
66 0.22
67 0.26
68 0.29
69 0.29
70 0.3
71 0.34
72 0.32
73 0.32
74 0.31
75 0.29
76 0.27
77 0.27
78 0.26
79 0.2
80 0.18
81 0.18
82 0.13
83 0.11
84 0.1
85 0.1
86 0.1
87 0.09
88 0.08
89 0.1
90 0.11
91 0.1
92 0.1
93 0.12
94 0.19
95 0.2
96 0.22
97 0.22
98 0.23
99 0.28
100 0.29
101 0.28
102 0.24
103 0.28
104 0.3
105 0.33
106 0.38
107 0.36
108 0.41
109 0.43
110 0.47
111 0.47
112 0.44
113 0.5
114 0.45
115 0.46
116 0.42
117 0.42
118 0.42
119 0.4
120 0.46
121 0.42
122 0.45
123 0.5
124 0.49
125 0.51
126 0.52
127 0.53
128 0.53
129 0.5
130 0.54
131 0.5
132 0.5
133 0.45
134 0.37
135 0.35
136 0.27
137 0.29
138 0.22
139 0.18
140 0.16
141 0.16
142 0.16
143 0.15
144 0.15
145 0.1
146 0.08
147 0.08
148 0.09
149 0.11
150 0.15
151 0.2
152 0.19
153 0.21
154 0.28
155 0.32
156 0.33
157 0.36
158 0.41
159 0.4
160 0.44
161 0.47
162 0.43
163 0.42
164 0.38
165 0.36
166 0.3
167 0.32
168 0.31
169 0.34
170 0.35
171 0.38
172 0.38
173 0.39
174 0.35
175 0.31
176 0.32
177 0.24
178 0.2
179 0.15
180 0.14
181 0.13
182 0.13
183 0.12
184 0.09
185 0.08
186 0.08
187 0.08
188 0.08
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.06
195 0.06
196 0.11
197 0.11
198 0.12
199 0.12
200 0.14
201 0.14
202 0.14
203 0.19
204 0.17
205 0.22
206 0.22
207 0.26
208 0.24
209 0.32
210 0.37
211 0.37
212 0.43
213 0.42
214 0.48
215 0.5
216 0.51
217 0.51
218 0.54
219 0.6
220 0.58
221 0.62
222 0.55
223 0.5
224 0.49
225 0.47
226 0.46
227 0.43
228 0.36
229 0.3
230 0.31
231 0.31
232 0.34
233 0.29
234 0.29
235 0.25
236 0.28
237 0.28
238 0.27
239 0.25
240 0.24
241 0.25
242 0.2
243 0.18