Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VE43

Protein Details
Accession A0A1M2VE43    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-57VVASGHQDQKRKKNRRDRRRQVAADSGAHydrophilic
190-210AADVRRAKRRREERNAICRLFHydrophilic
NLS Segment(s)
PositionSequence
39-49KRKKNRRDRRR
196-199AKRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSIEEQRSEGKRACLDGSDVYSKHLDMRPVVASGHQDQKRKKNRRDRRRQVAADSGAAADSLAKSLPQPSKSFIASPFYHVPDSWARALQDVSPVPRLEASAPYFFPPPFLLDTVSSQLPMPSECVCPTAARNDDKILRYLHNHLRIRRFCRMRLFDPSMSSVPLTVGEWRAALWGEFSEKGGEITGSSAADVRRAKRRREERNAICRLFGRVALLPSYREDRKASFLGKEFAAEDLIEASDVRRWVLWESHEINFRCEMMALDTYLVQRKDWQEIHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.32
5 0.32
6 0.29
7 0.29
8 0.28
9 0.27
10 0.3
11 0.29
12 0.27
13 0.23
14 0.27
15 0.26
16 0.26
17 0.26
18 0.22
19 0.23
20 0.24
21 0.33
22 0.34
23 0.4
24 0.46
25 0.57
26 0.66
27 0.72
28 0.78
29 0.79
30 0.86
31 0.9
32 0.94
33 0.94
34 0.94
35 0.94
36 0.9
37 0.85
38 0.83
39 0.74
40 0.64
41 0.54
42 0.43
43 0.31
44 0.25
45 0.19
46 0.1
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.12
53 0.18
54 0.21
55 0.22
56 0.25
57 0.29
58 0.3
59 0.32
60 0.28
61 0.29
62 0.26
63 0.3
64 0.31
65 0.29
66 0.29
67 0.26
68 0.28
69 0.26
70 0.28
71 0.24
72 0.22
73 0.2
74 0.2
75 0.21
76 0.18
77 0.19
78 0.17
79 0.18
80 0.19
81 0.18
82 0.18
83 0.17
84 0.17
85 0.14
86 0.16
87 0.17
88 0.16
89 0.17
90 0.18
91 0.19
92 0.18
93 0.18
94 0.15
95 0.13
96 0.13
97 0.13
98 0.13
99 0.12
100 0.14
101 0.15
102 0.15
103 0.13
104 0.11
105 0.11
106 0.1
107 0.09
108 0.09
109 0.09
110 0.1
111 0.1
112 0.11
113 0.11
114 0.11
115 0.12
116 0.16
117 0.18
118 0.19
119 0.19
120 0.21
121 0.25
122 0.25
123 0.26
124 0.23
125 0.2
126 0.21
127 0.26
128 0.29
129 0.35
130 0.38
131 0.4
132 0.47
133 0.52
134 0.55
135 0.59
136 0.56
137 0.51
138 0.56
139 0.58
140 0.52
141 0.55
142 0.55
143 0.47
144 0.45
145 0.44
146 0.36
147 0.3
148 0.26
149 0.18
150 0.12
151 0.11
152 0.1
153 0.08
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.07
160 0.07
161 0.06
162 0.05
163 0.07
164 0.07
165 0.08
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.06
172 0.06
173 0.07
174 0.06
175 0.06
176 0.08
177 0.07
178 0.13
179 0.16
180 0.19
181 0.28
182 0.34
183 0.4
184 0.48
185 0.59
186 0.64
187 0.72
188 0.8
189 0.8
190 0.85
191 0.87
192 0.78
193 0.7
194 0.6
195 0.53
196 0.43
197 0.33
198 0.26
199 0.19
200 0.2
201 0.21
202 0.2
203 0.18
204 0.19
205 0.25
206 0.23
207 0.24
208 0.25
209 0.25
210 0.3
211 0.33
212 0.33
213 0.32
214 0.34
215 0.34
216 0.32
217 0.3
218 0.25
219 0.22
220 0.2
221 0.14
222 0.11
223 0.09
224 0.09
225 0.08
226 0.07
227 0.07
228 0.09
229 0.1
230 0.1
231 0.1
232 0.11
233 0.14
234 0.18
235 0.2
236 0.25
237 0.29
238 0.33
239 0.41
240 0.4
241 0.4
242 0.38
243 0.35
244 0.28
245 0.24
246 0.2
247 0.17
248 0.17
249 0.15
250 0.14
251 0.15
252 0.18
253 0.24
254 0.23
255 0.2
256 0.25
257 0.27
258 0.35