Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VVT9

Protein Details
Accession A0A1M2VVT9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNVRTVKRKPRLSNVSRSNVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 8.5, plas 6, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MNVRTVKRKPRLSNVSRSNVSTASSATIIDPIANGHSGIRPVKTGSGSKPLPPPPKSLLFTFHQHSFNTMVAYADSTVHYHVTVCMNCFIPSSFITIIRREHEKGDFVSSFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.74
4 0.68
5 0.6
6 0.49
7 0.43
8 0.33
9 0.25
10 0.18
11 0.15
12 0.14
13 0.11
14 0.11
15 0.09
16 0.08
17 0.08
18 0.06
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.1
25 0.12
26 0.12
27 0.12
28 0.12
29 0.14
30 0.16
31 0.17
32 0.17
33 0.23
34 0.24
35 0.26
36 0.31
37 0.36
38 0.42
39 0.41
40 0.43
41 0.39
42 0.44
43 0.43
44 0.38
45 0.34
46 0.3
47 0.32
48 0.3
49 0.31
50 0.27
51 0.25
52 0.26
53 0.24
54 0.21
55 0.18
56 0.15
57 0.11
58 0.09
59 0.1
60 0.09
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.13
70 0.14
71 0.15
72 0.16
73 0.17
74 0.17
75 0.18
76 0.17
77 0.15
78 0.14
79 0.17
80 0.16
81 0.19
82 0.22
83 0.24
84 0.27
85 0.29
86 0.34
87 0.31
88 0.34
89 0.34
90 0.35
91 0.34
92 0.38