Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VEC2

Protein Details
Accession A0A1M2VEC2   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
16-41YDDALRPRKRTAKAPKPKVRPLLPPGHydrophilic
NLS Segment(s)
PositionSequence
21-36RPRKRTAKAPKPKVRP
Subcellular Location(s) mito 12, nucl 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MKTKLARKTAKGQQPYDDALRPRKRTAKAPKPKVRPLLPPGLASSGLSSAPAPGAVPFRDLCEERVRELYPGLKPRNDFDLLQLASEHYKGTNAEVLAALDVDLAETSEDLGYEFMMEESTKCLDALVEPTGVKPGQSAYVHHKFVFVRPIPDCKYSLRLFPGSLSAAEYCLDFVDSATGEPVNSPFEYELWAVPDPDTPWLSMPITGKLRSIERGHGIKQEDILLGEEKFVLRDGQTCVLMRPGKQPVRFTVPLRRVETTDVVEDVYVIDLPKVVGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.6
4 0.56
5 0.52
6 0.54
7 0.6
8 0.58
9 0.61
10 0.64
11 0.64
12 0.68
13 0.73
14 0.74
15 0.76
16 0.82
17 0.85
18 0.86
19 0.9
20 0.89
21 0.84
22 0.82
23 0.78
24 0.77
25 0.69
26 0.61
27 0.54
28 0.47
29 0.41
30 0.32
31 0.26
32 0.17
33 0.14
34 0.13
35 0.11
36 0.08
37 0.08
38 0.08
39 0.07
40 0.07
41 0.11
42 0.1
43 0.13
44 0.13
45 0.15
46 0.19
47 0.2
48 0.22
49 0.27
50 0.28
51 0.28
52 0.32
53 0.3
54 0.27
55 0.27
56 0.29
57 0.26
58 0.34
59 0.36
60 0.35
61 0.36
62 0.37
63 0.41
64 0.39
65 0.33
66 0.27
67 0.31
68 0.28
69 0.27
70 0.25
71 0.2
72 0.18
73 0.18
74 0.15
75 0.07
76 0.08
77 0.08
78 0.09
79 0.11
80 0.1
81 0.11
82 0.11
83 0.11
84 0.09
85 0.09
86 0.07
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.03
100 0.04
101 0.04
102 0.03
103 0.04
104 0.04
105 0.04
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.1
119 0.1
120 0.09
121 0.07
122 0.07
123 0.1
124 0.1
125 0.13
126 0.19
127 0.25
128 0.26
129 0.26
130 0.28
131 0.24
132 0.26
133 0.32
134 0.25
135 0.23
136 0.23
137 0.29
138 0.29
139 0.31
140 0.31
141 0.24
142 0.29
143 0.26
144 0.27
145 0.25
146 0.23
147 0.22
148 0.2
149 0.21
150 0.16
151 0.15
152 0.14
153 0.1
154 0.1
155 0.1
156 0.09
157 0.07
158 0.06
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.05
168 0.06
169 0.06
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.11
176 0.11
177 0.11
178 0.12
179 0.12
180 0.12
181 0.12
182 0.14
183 0.12
184 0.14
185 0.15
186 0.12
187 0.12
188 0.14
189 0.14
190 0.16
191 0.16
192 0.2
193 0.23
194 0.23
195 0.24
196 0.24
197 0.25
198 0.28
199 0.29
200 0.27
201 0.3
202 0.34
203 0.35
204 0.38
205 0.38
206 0.34
207 0.33
208 0.3
209 0.24
210 0.21
211 0.2
212 0.16
213 0.14
214 0.13
215 0.12
216 0.1
217 0.1
218 0.1
219 0.09
220 0.08
221 0.11
222 0.15
223 0.18
224 0.2
225 0.2
226 0.21
227 0.27
228 0.29
229 0.27
230 0.31
231 0.38
232 0.43
233 0.47
234 0.5
235 0.49
236 0.56
237 0.59
238 0.56
239 0.57
240 0.57
241 0.61
242 0.62
243 0.58
244 0.51
245 0.51
246 0.51
247 0.44
248 0.38
249 0.31
250 0.26
251 0.23
252 0.21
253 0.16
254 0.13
255 0.1
256 0.08
257 0.07
258 0.07