Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VMD4

Protein Details
Accession A0A1M2VMD4    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-44ESVRNLIKKKPKYSKRVNYNALKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011665  BRF1_TBP-bd_dom  
Pfam View protein in Pfam  
PF07741  BRF1  
Amino Acid Sequences RRKTNNKPRDASTSHGSTAAESVRNLIKKKPKYSKRVNYNALKDVFTDAGSAFQAPAADDENAEGWRVGRVRAGGMIGEQSGVKSAVYQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.37
4 0.28
5 0.26
6 0.23
7 0.18
8 0.13
9 0.15
10 0.18
11 0.22
12 0.23
13 0.28
14 0.35
15 0.41
16 0.51
17 0.6
18 0.64
19 0.7
20 0.8
21 0.83
22 0.84
23 0.85
24 0.84
25 0.81
26 0.76
27 0.72
28 0.63
29 0.52
30 0.42
31 0.34
32 0.26
33 0.19
34 0.14
35 0.08
36 0.08
37 0.07
38 0.07
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.09
50 0.09
51 0.08
52 0.06
53 0.1
54 0.1
55 0.1
56 0.11
57 0.12
58 0.13
59 0.14
60 0.14
61 0.11
62 0.11
63 0.12
64 0.1
65 0.1
66 0.09
67 0.08
68 0.09
69 0.09