Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W8B8

Protein Details
Accession A0A1M2W8B8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-89GVSRPARKPRGPKTAKKSKKPVVKPGKKPTKKPGRKPVVKLTGIBasic
NLS Segment(s)
PositionSequence
35-84PPPPRAPAPAPGVSRPARKPRGPKTAKKSKKPVVKPGKKPTKKPGRKPVV
Subcellular Location(s) nucl 15, cyto_nucl 14, cyto 9
Family & Domain DBs
Amino Acid Sequences MAAPPSEISAPPHADLFGSAHPPPLPPAASSLPPPPPPRAPAPAPGVSRPARKPRGPKTAKKSKKPVVKPGKKPTKKPGRKPVVKLTGIIPRPPIPAPTLNAVGERVLVCPVPRHLCGLEQKNAYRPVDMERHLNSHFPPASGAKPHFCKGLPVEDFSEDLFKGLPEKLKEIRLGDDGDVAFVGGCGKRYARPDSLMRHARGCLSKKYCALVYLDDDDDGSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.17
5 0.18
6 0.18
7 0.2
8 0.2
9 0.21
10 0.22
11 0.22
12 0.2
13 0.16
14 0.21
15 0.22
16 0.24
17 0.26
18 0.29
19 0.31
20 0.36
21 0.39
22 0.39
23 0.4
24 0.42
25 0.45
26 0.46
27 0.44
28 0.44
29 0.47
30 0.48
31 0.47
32 0.44
33 0.45
34 0.42
35 0.46
36 0.46
37 0.5
38 0.51
39 0.55
40 0.63
41 0.66
42 0.73
43 0.75
44 0.78
45 0.78
46 0.82
47 0.85
48 0.85
49 0.86
50 0.83
51 0.85
52 0.83
53 0.84
54 0.84
55 0.85
56 0.85
57 0.86
58 0.89
59 0.85
60 0.85
61 0.84
62 0.84
63 0.84
64 0.84
65 0.84
66 0.84
67 0.85
68 0.84
69 0.84
70 0.82
71 0.73
72 0.63
73 0.56
74 0.52
75 0.45
76 0.4
77 0.32
78 0.24
79 0.25
80 0.24
81 0.22
82 0.17
83 0.18
84 0.19
85 0.19
86 0.2
87 0.17
88 0.17
89 0.17
90 0.14
91 0.12
92 0.11
93 0.08
94 0.07
95 0.06
96 0.06
97 0.07
98 0.1
99 0.12
100 0.12
101 0.13
102 0.13
103 0.17
104 0.23
105 0.27
106 0.29
107 0.29
108 0.3
109 0.33
110 0.37
111 0.34
112 0.28
113 0.24
114 0.23
115 0.25
116 0.26
117 0.25
118 0.22
119 0.25
120 0.26
121 0.27
122 0.23
123 0.25
124 0.24
125 0.19
126 0.2
127 0.18
128 0.2
129 0.23
130 0.24
131 0.23
132 0.26
133 0.27
134 0.27
135 0.25
136 0.27
137 0.25
138 0.32
139 0.28
140 0.27
141 0.28
142 0.26
143 0.27
144 0.23
145 0.23
146 0.14
147 0.12
148 0.1
149 0.08
150 0.09
151 0.11
152 0.15
153 0.15
154 0.2
155 0.23
156 0.26
157 0.3
158 0.3
159 0.31
160 0.29
161 0.29
162 0.25
163 0.25
164 0.21
165 0.18
166 0.16
167 0.13
168 0.1
169 0.08
170 0.09
171 0.06
172 0.07
173 0.09
174 0.1
175 0.15
176 0.2
177 0.26
178 0.28
179 0.33
180 0.39
181 0.44
182 0.53
183 0.57
184 0.55
185 0.52
186 0.49
187 0.5
188 0.51
189 0.49
190 0.49
191 0.47
192 0.51
193 0.51
194 0.54
195 0.49
196 0.43
197 0.41
198 0.35
199 0.35
200 0.33
201 0.3
202 0.26