Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VPS1

Protein Details
Accession A0A1M2VPS1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
211-232KTNGKARRPNFVRKETRHDGRTBasic
NLS Segment(s)
PositionSequence
93-101RGRSRTRGG
205-219RSPLGGKTNGKARRP
Subcellular Location(s) mito 19, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSHRPQPHPILKRDSSPFRTPILPFSTCGQPLFSPHVHFPPTPRLVAGTYPAHSPTTYDRAPIAVTPNICQLPRRGERTVRAPSAEGPEGEGRGRSRTRGGNSKRGENVKGSYFHPRAYEACKPEPLNVPGTPFAMPSTPPLIQDLSPSDESDTTVTTPPDPNLAAAMAECPMPLRLPVTPVNLPHRRRPHPDKADVGSPPPALRSPLGGKTNGKARRPNFVRKETRHDGRTVSFSPDMDEGCLGGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.67
3 0.65
4 0.61
5 0.55
6 0.57
7 0.5
8 0.48
9 0.45
10 0.39
11 0.35
12 0.36
13 0.39
14 0.35
15 0.34
16 0.3
17 0.24
18 0.26
19 0.31
20 0.3
21 0.27
22 0.28
23 0.33
24 0.34
25 0.34
26 0.34
27 0.38
28 0.39
29 0.35
30 0.33
31 0.3
32 0.28
33 0.28
34 0.29
35 0.23
36 0.2
37 0.21
38 0.22
39 0.21
40 0.19
41 0.2
42 0.2
43 0.23
44 0.22
45 0.22
46 0.21
47 0.21
48 0.22
49 0.21
50 0.2
51 0.17
52 0.17
53 0.17
54 0.21
55 0.22
56 0.22
57 0.21
58 0.2
59 0.26
60 0.32
61 0.36
62 0.36
63 0.39
64 0.44
65 0.51
66 0.55
67 0.48
68 0.43
69 0.38
70 0.36
71 0.37
72 0.33
73 0.25
74 0.2
75 0.19
76 0.18
77 0.18
78 0.17
79 0.13
80 0.17
81 0.17
82 0.16
83 0.19
84 0.24
85 0.29
86 0.37
87 0.41
88 0.46
89 0.48
90 0.52
91 0.53
92 0.51
93 0.48
94 0.41
95 0.38
96 0.31
97 0.31
98 0.27
99 0.31
100 0.28
101 0.28
102 0.26
103 0.25
104 0.23
105 0.26
106 0.3
107 0.26
108 0.27
109 0.29
110 0.29
111 0.3
112 0.33
113 0.29
114 0.28
115 0.24
116 0.24
117 0.21
118 0.21
119 0.19
120 0.14
121 0.13
122 0.1
123 0.1
124 0.09
125 0.12
126 0.11
127 0.12
128 0.13
129 0.13
130 0.13
131 0.14
132 0.14
133 0.15
134 0.15
135 0.15
136 0.14
137 0.13
138 0.14
139 0.13
140 0.12
141 0.09
142 0.1
143 0.11
144 0.11
145 0.12
146 0.12
147 0.13
148 0.13
149 0.11
150 0.1
151 0.1
152 0.08
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.07
163 0.07
164 0.11
165 0.15
166 0.19
167 0.21
168 0.25
169 0.34
170 0.41
171 0.44
172 0.49
173 0.56
174 0.58
175 0.65
176 0.7
177 0.72
178 0.73
179 0.77
180 0.75
181 0.69
182 0.68
183 0.6
184 0.54
185 0.47
186 0.38
187 0.31
188 0.27
189 0.24
190 0.2
191 0.19
192 0.21
193 0.22
194 0.29
195 0.31
196 0.33
197 0.35
198 0.36
199 0.45
200 0.48
201 0.49
202 0.5
203 0.49
204 0.56
205 0.61
206 0.68
207 0.68
208 0.71
209 0.76
210 0.73
211 0.81
212 0.79
213 0.82
214 0.75
215 0.68
216 0.63
217 0.57
218 0.57
219 0.49
220 0.46
221 0.4
222 0.36
223 0.35
224 0.33
225 0.29
226 0.23
227 0.21