Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VJR7

Protein Details
Accession A0A1M2VJR7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-35DLLRIRPKGRAARRSQREVEHydrophilic
NLS Segment(s)
PositionSequence
23-27KGRAA
Subcellular Location(s) mito 14, cyto 6.5, cyto_nucl 6.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022812  Dynamin  
IPR045063  Dynamin_N  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF00350  Dynamin_N  
Amino Acid Sequences MPAGALHRRVVLPNQDLLRIRPKGRAARRSQREVEHMLRRAQEAVLHPDVKFEVFLEDGWQEKVKGKQPLRFSQNIVCIELTGPDLTDLSFVDLPGIVQNAESEVVNLVEDMVNNYIKGTSLILVTLLMSDDIENQKAARLAHLADPKGHRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.39
4 0.39
5 0.43
6 0.41
7 0.39
8 0.4
9 0.46
10 0.51
11 0.59
12 0.65
13 0.66
14 0.72
15 0.78
16 0.8
17 0.78
18 0.73
19 0.68
20 0.65
21 0.63
22 0.61
23 0.56
24 0.51
25 0.47
26 0.43
27 0.38
28 0.32
29 0.27
30 0.22
31 0.25
32 0.25
33 0.25
34 0.24
35 0.24
36 0.24
37 0.2
38 0.17
39 0.11
40 0.08
41 0.07
42 0.07
43 0.08
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.12
50 0.17
51 0.21
52 0.29
53 0.32
54 0.36
55 0.43
56 0.5
57 0.52
58 0.5
59 0.47
60 0.43
61 0.45
62 0.41
63 0.36
64 0.28
65 0.22
66 0.2
67 0.18
68 0.14
69 0.07
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.04
85 0.04
86 0.04
87 0.05
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.05
116 0.05
117 0.05
118 0.09
119 0.11
120 0.12
121 0.12
122 0.12
123 0.15
124 0.17
125 0.17
126 0.15
127 0.15
128 0.16
129 0.24
130 0.31
131 0.3
132 0.33
133 0.38