Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VJF5

Protein Details
Accession A0A1M2VJF5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-42GRWGPVTKRVWKCKICKRVLRIRRCVNPKKANYGRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MVAVKRFGRWGPVTKRVWKCKICKRVLRIRRCVNPKKANYGRSFVMCHPHDADDNEVHPKHYRYCNNWIPASGTQRTVDSDSEGPFDASPSDPASSTTSTSNPDERRRCQLQSCGSKCVADNCGRSYCSKHCEAAGGCFVHRALSVEDLLQLGLQPRPIKPASDYPTLREGLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.74
4 0.79
5 0.77
6 0.79
7 0.8
8 0.84
9 0.84
10 0.83
11 0.82
12 0.84
13 0.86
14 0.86
15 0.86
16 0.85
17 0.85
18 0.86
19 0.87
20 0.87
21 0.87
22 0.81
23 0.82
24 0.8
25 0.78
26 0.72
27 0.66
28 0.58
29 0.51
30 0.49
31 0.4
32 0.42
33 0.34
34 0.33
35 0.3
36 0.29
37 0.28
38 0.26
39 0.27
40 0.2
41 0.21
42 0.24
43 0.22
44 0.22
45 0.22
46 0.23
47 0.25
48 0.32
49 0.36
50 0.36
51 0.45
52 0.5
53 0.53
54 0.51
55 0.46
56 0.42
57 0.4
58 0.39
59 0.32
60 0.27
61 0.22
62 0.22
63 0.23
64 0.2
65 0.17
66 0.14
67 0.14
68 0.13
69 0.14
70 0.13
71 0.12
72 0.1
73 0.1
74 0.08
75 0.07
76 0.07
77 0.07
78 0.08
79 0.07
80 0.09
81 0.11
82 0.12
83 0.12
84 0.13
85 0.13
86 0.15
87 0.17
88 0.22
89 0.24
90 0.32
91 0.37
92 0.39
93 0.46
94 0.47
95 0.49
96 0.47
97 0.5
98 0.5
99 0.55
100 0.55
101 0.51
102 0.48
103 0.45
104 0.42
105 0.38
106 0.34
107 0.29
108 0.28
109 0.28
110 0.3
111 0.3
112 0.31
113 0.32
114 0.33
115 0.32
116 0.33
117 0.3
118 0.28
119 0.33
120 0.32
121 0.31
122 0.31
123 0.27
124 0.24
125 0.24
126 0.23
127 0.18
128 0.17
129 0.15
130 0.11
131 0.13
132 0.13
133 0.12
134 0.13
135 0.12
136 0.12
137 0.1
138 0.09
139 0.09
140 0.09
141 0.13
142 0.15
143 0.15
144 0.22
145 0.23
146 0.25
147 0.28
148 0.37
149 0.38
150 0.46
151 0.47
152 0.45
153 0.49