Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W437

Protein Details
Accession A0A1M2W437    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MEGSRFRRRRREFLRAPQITTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR037151  AlkB-like_sf  
Amino Acid Sequences MEGSRFRRRRREFLRAPQITTTQDSVQALFLPDELYDFQEGHFDGVIKYYREMHVTSWPEDMPELPSLLERLRTVHPNEDTQTHILHLASSGEIMVGGIEHPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.81
3 0.76
4 0.69
5 0.63
6 0.54
7 0.47
8 0.39
9 0.28
10 0.27
11 0.24
12 0.21
13 0.19
14 0.16
15 0.14
16 0.11
17 0.1
18 0.08
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.09
27 0.09
28 0.09
29 0.08
30 0.07
31 0.06
32 0.09
33 0.1
34 0.09
35 0.1
36 0.11
37 0.11
38 0.13
39 0.14
40 0.13
41 0.18
42 0.2
43 0.21
44 0.21
45 0.2
46 0.18
47 0.18
48 0.17
49 0.12
50 0.1
51 0.09
52 0.08
53 0.08
54 0.09
55 0.09
56 0.11
57 0.09
58 0.11
59 0.14
60 0.19
61 0.21
62 0.27
63 0.29
64 0.32
65 0.33
66 0.32
67 0.32
68 0.29
69 0.27
70 0.21
71 0.2
72 0.16
73 0.14
74 0.12
75 0.1
76 0.09
77 0.08
78 0.07
79 0.06
80 0.06
81 0.05
82 0.04
83 0.04
84 0.04