Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VC41

Protein Details
Accession A0A1M2VC41    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
299-321AALVWFLRRRKRQLKLRQLNIAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 4, golg 2, cyto 1, plas 1, extr 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASLIAAYTRRKQTLRDISSNSTFTPLHKPDNHGGPSSSSSGENLDTNGCHGGDDNGQSDNNGGKSGGDGGDDDKNGDGSNGNCQSGSSSSQNGQHGNASSGNDSGQGGSPGQNFNDCGAALKPLMPDPRLCMAVNENDGRLKYGTGWVLSSGDPNGRSLTSHSTTVNGSSVVVDFSGTSIVVFGTVPPGNMSAVPPSASYSIDGRRAFELSLPASNRCIPNQQFFQSPTLSPGEHNLTINVTTTGSPYILDYLWFCGPSAPSADSSGTSSKTVHDGFSRVDAIVVGSVGGVIFLLGVAALVWFLRRRKRQLKLRQLNIAPSPVSSWLHSQNYSGSGTEIVFTSTESIMRDNPTDSSTADSKEHQRKTLDLSMPITTTFPDLPPGLASSPPVFHNTPEGHTSLAPPPWTVRSLSTAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.63
4 0.63
5 0.64
6 0.68
7 0.66
8 0.55
9 0.48
10 0.4
11 0.35
12 0.39
13 0.36
14 0.4
15 0.42
16 0.48
17 0.51
18 0.59
19 0.6
20 0.52
21 0.49
22 0.44
23 0.42
24 0.39
25 0.33
26 0.24
27 0.22
28 0.21
29 0.21
30 0.18
31 0.16
32 0.15
33 0.14
34 0.15
35 0.16
36 0.14
37 0.13
38 0.12
39 0.13
40 0.15
41 0.17
42 0.17
43 0.17
44 0.17
45 0.17
46 0.18
47 0.18
48 0.15
49 0.14
50 0.12
51 0.1
52 0.11
53 0.14
54 0.13
55 0.1
56 0.1
57 0.12
58 0.16
59 0.16
60 0.16
61 0.14
62 0.13
63 0.13
64 0.13
65 0.12
66 0.09
67 0.18
68 0.2
69 0.2
70 0.19
71 0.19
72 0.21
73 0.21
74 0.25
75 0.19
76 0.19
77 0.21
78 0.27
79 0.3
80 0.3
81 0.28
82 0.27
83 0.26
84 0.25
85 0.25
86 0.21
87 0.18
88 0.17
89 0.16
90 0.14
91 0.13
92 0.12
93 0.1
94 0.1
95 0.1
96 0.12
97 0.14
98 0.14
99 0.14
100 0.15
101 0.15
102 0.14
103 0.15
104 0.12
105 0.12
106 0.11
107 0.12
108 0.11
109 0.12
110 0.12
111 0.14
112 0.18
113 0.17
114 0.17
115 0.2
116 0.23
117 0.23
118 0.22
119 0.2
120 0.2
121 0.23
122 0.26
123 0.23
124 0.21
125 0.2
126 0.2
127 0.2
128 0.18
129 0.14
130 0.11
131 0.13
132 0.14
133 0.13
134 0.13
135 0.12
136 0.13
137 0.13
138 0.13
139 0.1
140 0.11
141 0.11
142 0.11
143 0.12
144 0.1
145 0.11
146 0.12
147 0.18
148 0.17
149 0.19
150 0.18
151 0.19
152 0.19
153 0.19
154 0.18
155 0.11
156 0.09
157 0.08
158 0.08
159 0.07
160 0.06
161 0.05
162 0.04
163 0.04
164 0.05
165 0.04
166 0.04
167 0.04
168 0.03
169 0.04
170 0.04
171 0.03
172 0.07
173 0.07
174 0.07
175 0.07
176 0.08
177 0.08
178 0.08
179 0.09
180 0.07
181 0.07
182 0.07
183 0.07
184 0.08
185 0.09
186 0.09
187 0.09
188 0.1
189 0.12
190 0.18
191 0.18
192 0.18
193 0.18
194 0.18
195 0.17
196 0.16
197 0.16
198 0.11
199 0.14
200 0.14
201 0.14
202 0.15
203 0.17
204 0.17
205 0.16
206 0.22
207 0.2
208 0.24
209 0.27
210 0.28
211 0.28
212 0.29
213 0.3
214 0.25
215 0.23
216 0.21
217 0.19
218 0.18
219 0.15
220 0.16
221 0.17
222 0.17
223 0.17
224 0.15
225 0.14
226 0.14
227 0.14
228 0.12
229 0.08
230 0.07
231 0.08
232 0.08
233 0.07
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.09
241 0.1
242 0.1
243 0.1
244 0.09
245 0.1
246 0.1
247 0.12
248 0.1
249 0.11
250 0.12
251 0.13
252 0.12
253 0.14
254 0.15
255 0.14
256 0.14
257 0.13
258 0.13
259 0.16
260 0.16
261 0.15
262 0.15
263 0.16
264 0.16
265 0.18
266 0.18
267 0.14
268 0.13
269 0.12
270 0.11
271 0.09
272 0.08
273 0.05
274 0.04
275 0.04
276 0.03
277 0.03
278 0.02
279 0.02
280 0.02
281 0.02
282 0.02
283 0.02
284 0.02
285 0.02
286 0.02
287 0.02
288 0.02
289 0.04
290 0.07
291 0.12
292 0.21
293 0.28
294 0.39
295 0.48
296 0.59
297 0.68
298 0.76
299 0.83
300 0.85
301 0.86
302 0.85
303 0.78
304 0.74
305 0.66
306 0.58
307 0.47
308 0.36
309 0.3
310 0.24
311 0.23
312 0.18
313 0.2
314 0.23
315 0.27
316 0.27
317 0.26
318 0.25
319 0.27
320 0.27
321 0.23
322 0.17
323 0.14
324 0.14
325 0.13
326 0.11
327 0.09
328 0.08
329 0.08
330 0.1
331 0.09
332 0.1
333 0.11
334 0.12
335 0.14
336 0.16
337 0.18
338 0.17
339 0.18
340 0.18
341 0.18
342 0.17
343 0.2
344 0.19
345 0.21
346 0.21
347 0.24
348 0.33
349 0.41
350 0.45
351 0.46
352 0.46
353 0.45
354 0.51
355 0.56
356 0.51
357 0.46
358 0.44
359 0.41
360 0.4
361 0.38
362 0.3
363 0.21
364 0.2
365 0.17
366 0.14
367 0.16
368 0.16
369 0.16
370 0.17
371 0.19
372 0.17
373 0.16
374 0.19
375 0.17
376 0.19
377 0.2
378 0.24
379 0.22
380 0.21
381 0.29
382 0.28
383 0.3
384 0.31
385 0.31
386 0.27
387 0.27
388 0.3
389 0.28
390 0.29
391 0.27
392 0.25
393 0.27
394 0.29
395 0.31
396 0.29
397 0.26