FuNGI

A0A1M2W486

Protein Details

Accession

A0A1M2W486

Localization Confidence

Low

Confidence Score

5.8

NoLS Segment(s)

Position	Sequence	Protein Nature
2-25	NERLNPRQAGRQCRRRPIVSHCRG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 19, cyto 5, nucl 2

Family & Domain DBs

InterPro	View protein in InterPro IPR006680 Amidohydro-rel IPR011059 Metal-dep_hydrolase_composite IPR032466 Metal_Hydrolase
Gene Ontology	GO:0016810 F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Pfam	View protein in Pfam PF01979 Amidohydro_1

Amino Acid Sequences

MNERLNPRQAGRQCRRRPIVSHCRGIHKPPXPLDHFTTRRYWHMLERNLLRGTFVHTPVLGTVEILRDHLLRTNERGYIDYFADASIQASQEIIAGTHPTIVPAGSFVLPTFCDLHLHAPQFLYQGTGLHLPLMEWLNEYAFKAEESLDADPALAERVYKRLATRLVEHGTGAVLLFGTIKTETNLILARVMQDAGVRAFVGKLSMDISSRPSYVEASADASLSAARSFCERCTEMSRALPAHARLVEPVLTPRFVPTCSKPLLVGLGELSAQTGVRIQSHMAEAHDQVQHVLSAHGEADMHVFAQSALLTPRTVQAHCTFLDPVDLKALAETGAAVAHCPLSNAYFSAAPFRLREALDAGVRVGLGTDIAGGYSVDIMSAMRHAVAVSRMREGTQILQADARGAHALSAGAAGGPVSVDWRDALHLATRGGAVALGLPEGCGTFTVGAPFDAQCSEWCTRHRRHVVGLTYRSTVRLLDEETNEGVGALDFFDTEDRVSPWTPTLEAIEKWWCVGDTRNRADMWVQGAHVYPAENRA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.79
2	0.84
3	0.81
4	0.8
5	0.8
6	0.81
7	0.79
8	0.79
9	0.73
10	0.74
11	0.72
12	0.73
13	0.7
14	0.68
15	0.66
16	0.62
17	0.65
18	0.63
19	0.65
20	0.64
21	0.64
22	0.6
23	0.61
24	0.58
25	0.56
26	0.54
27	0.51
28	0.53
29	0.55
30	0.57
31	0.57
32	0.59
33	0.6
34	0.57
35	0.54
36	0.46
37	0.37
38	0.36
39	0.33
40	0.3
41	0.25
42	0.23
43	0.23
44	0.23
45	0.24
46	0.18
47	0.12
48	0.12
49	0.12
50	0.13
51	0.13
52	0.14
53	0.12
54	0.13
55	0.18
56	0.21
57	0.21
58	0.26
59	0.29
60	0.31
61	0.31
62	0.32
63	0.29
64	0.28
65	0.26
66	0.21
67	0.18
68	0.15
69	0.14
70	0.12
71	0.11
72	0.1
73	0.09
74	0.08
75	0.08
76	0.08
77	0.08
78	0.08
79	0.07
80	0.06
81	0.07
82	0.08
83	0.1
84	0.09
85	0.09
86	0.09
87	0.09
88	0.08
89	0.08
90	0.1
91	0.08
92	0.08
93	0.08
94	0.09
95	0.09
96	0.11
97	0.13
98	0.11
99	0.12
100	0.13
101	0.19
102	0.23
103	0.24
104	0.23
105	0.21
106	0.22
107	0.22
108	0.21
109	0.17
110	0.11
111	0.1
112	0.11
113	0.12
114	0.11
115	0.11
116	0.1
117	0.09
118	0.12
119	0.12
120	0.11
121	0.1
122	0.1
123	0.11
124	0.12
125	0.12
126	0.1
127	0.09
128	0.09
129	0.09
130	0.09
131	0.09
132	0.11
133	0.11
134	0.11
135	0.11
136	0.1
137	0.09
138	0.09
139	0.09
140	0.06
141	0.06
142	0.06
143	0.09
144	0.11
145	0.13
146	0.14
147	0.18
148	0.22
149	0.24
150	0.27
151	0.31
152	0.32
153	0.31
154	0.3
155	0.25
156	0.21
157	0.18
158	0.14
159	0.07
160	0.04
161	0.04
162	0.04
163	0.04
164	0.05
165	0.05
166	0.06
167	0.06
168	0.07
169	0.07
170	0.08
171	0.1
172	0.09
173	0.09
174	0.09
175	0.09
176	0.09
177	0.09
178	0.08
179	0.07
180	0.08
181	0.07
182	0.07
183	0.06
184	0.06
185	0.06
186	0.06
187	0.06
188	0.05
189	0.05
190	0.06
191	0.06
192	0.07
193	0.07
194	0.12
195	0.13
196	0.13
197	0.13
198	0.13
199	0.13
200	0.13
201	0.13
202	0.09
203	0.1
204	0.1
205	0.1
206	0.09
207	0.08
208	0.07
209	0.07
210	0.07
211	0.04
212	0.04
213	0.07
214	0.08
215	0.08
216	0.13
217	0.14
218	0.16
219	0.21
220	0.24
221	0.24
222	0.24
223	0.26
224	0.22
225	0.22
226	0.22
227	0.17
228	0.17
229	0.16
230	0.15
231	0.13
232	0.13
233	0.13
234	0.11
235	0.13
236	0.11
237	0.11
238	0.11
239	0.12
240	0.11
241	0.12
242	0.15
243	0.15
244	0.19
245	0.2
246	0.21
247	0.19
248	0.19
249	0.19
250	0.16
251	0.13
252	0.08
253	0.07
254	0.06
255	0.06
256	0.06
257	0.04
258	0.04
259	0.03
260	0.05
261	0.05
262	0.05
263	0.06
264	0.06
265	0.07
266	0.09
267	0.09
268	0.09
269	0.1
270	0.1
271	0.13
272	0.14
273	0.12
274	0.11
275	0.11
276	0.1
277	0.09
278	0.09
279	0.05
280	0.05
281	0.05
282	0.05
283	0.05
284	0.04
285	0.05
286	0.05
287	0.05
288	0.05
289	0.05
290	0.04
291	0.05
292	0.05
293	0.04
294	0.05
295	0.06
296	0.06
297	0.06
298	0.1
299	0.12
300	0.12
301	0.14
302	0.15
303	0.17
304	0.18
305	0.19
306	0.16
307	0.14
308	0.18
309	0.16
310	0.14
311	0.13
312	0.13
313	0.11
314	0.11
315	0.11
316	0.06
317	0.06
318	0.05
319	0.03
320	0.04
321	0.04
322	0.04
323	0.04
324	0.05
325	0.05
326	0.05
327	0.06
328	0.06
329	0.07
330	0.07
331	0.08
332	0.09
333	0.09
334	0.14
335	0.14
336	0.15
337	0.15
338	0.16
339	0.18
340	0.17
341	0.18
342	0.15
343	0.17
344	0.16
345	0.16
346	0.14
347	0.11
348	0.11
349	0.09
350	0.07
351	0.04
352	0.04
353	0.03
354	0.03
355	0.03
356	0.03
357	0.03
358	0.03
359	0.03
360	0.04
361	0.03
362	0.03
363	0.03
364	0.03
365	0.04
366	0.04
367	0.04
368	0.04
369	0.04
370	0.04
371	0.06
372	0.1
373	0.15
374	0.16
375	0.19
376	0.19
377	0.19
378	0.2
379	0.21
380	0.19
381	0.19
382	0.19
383	0.17
384	0.17
385	0.17
386	0.17
387	0.15
388	0.14
389	0.09
390	0.08
391	0.07
392	0.07
393	0.07
394	0.06
395	0.06
396	0.05
397	0.04
398	0.04
399	0.04
400	0.03
401	0.03
402	0.03
403	0.04
404	0.04
405	0.05
406	0.06
407	0.06
408	0.08
409	0.08
410	0.09
411	0.11
412	0.13
413	0.13
414	0.13
415	0.13
416	0.12
417	0.11
418	0.1
419	0.07
420	0.06
421	0.06
422	0.05
423	0.05
424	0.05
425	0.05
426	0.05
427	0.05
428	0.05
429	0.06
430	0.06
431	0.07
432	0.09
433	0.09
434	0.1
435	0.11
436	0.11
437	0.11
438	0.11
439	0.11
440	0.1
441	0.16
442	0.19
443	0.21
444	0.27
445	0.34
446	0.4
447	0.5
448	0.57
449	0.56
450	0.59
451	0.64
452	0.67
453	0.69
454	0.68
455	0.61
456	0.56
457	0.52
458	0.46
459	0.38
460	0.3
461	0.23
462	0.2
463	0.21
464	0.23
465	0.25
466	0.26
467	0.26
468	0.26
469	0.23
470	0.2
471	0.16
472	0.11
473	0.09
474	0.06
475	0.05
476	0.05
477	0.05
478	0.06
479	0.07
480	0.07
481	0.09
482	0.1
483	0.13
484	0.14
485	0.15
486	0.17
487	0.19
488	0.19
489	0.18
490	0.22
491	0.23
492	0.23
493	0.26
494	0.28
495	0.26
496	0.26
497	0.26
498	0.21
499	0.19
500	0.27
501	0.33
502	0.38
503	0.44
504	0.48
505	0.46
506	0.47
507	0.47
508	0.43
509	0.38
510	0.3
511	0.25
512	0.22
513	0.23
514	0.23
515	0.22
516	0.19

A0A1M2W486

3D AlphaFold-predicted Structure Viewer