Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2W3Q2

Protein Details
Accession A0A1M2W3Q2    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSHSPSPPRPNKRARHSDGADHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
Pfam View protein in Pfam  
PF00651  BTB  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MSHSPSPPRPNKRARHSDGADSPLADVEHDPDFWLEDGNIVVVAQNTAFRVHRGVLARRSEVFSGLFTVPQPEYEVGVEKIDGCPVVRVQDSLHDFKHFLHALYDGME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.78
4 0.77
5 0.72
6 0.66
7 0.56
8 0.45
9 0.38
10 0.29
11 0.25
12 0.17
13 0.12
14 0.1
15 0.1
16 0.1
17 0.1
18 0.08
19 0.09
20 0.09
21 0.09
22 0.07
23 0.06
24 0.06
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.07
36 0.07
37 0.08
38 0.09
39 0.12
40 0.15
41 0.18
42 0.23
43 0.25
44 0.26
45 0.26
46 0.27
47 0.24
48 0.21
49 0.18
50 0.13
51 0.13
52 0.12
53 0.12
54 0.1
55 0.12
56 0.11
57 0.11
58 0.13
59 0.1
60 0.11
61 0.11
62 0.14
63 0.12
64 0.13
65 0.12
66 0.11
67 0.11
68 0.1
69 0.1
70 0.08
71 0.09
72 0.09
73 0.13
74 0.13
75 0.13
76 0.13
77 0.21
78 0.25
79 0.28
80 0.29
81 0.28
82 0.28
83 0.28
84 0.36
85 0.29
86 0.24
87 0.22
88 0.22