Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2V1U2

Protein Details
Accession A0A1M2V1U2   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
308-327SNKTPKPSTPRKSKDAQQTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003738  SRAP  
IPR036590  SRAP-like  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0006974  P:DNA damage response  
GO:0018142  P:protein-DNA covalent cross-linking  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02586  SRAP  
Amino Acid Sequences MKWGLVPHFNKHEDKSLNTINARSEALVEGHTGMWASIKGKKRCAVVCEGYYEWLKKGKERLPHFTKHKDGRLMLLAGLWDCAILEGSTEPLWTFSIVTTDACKEFSWLHERQPVILPDEAALSTWLDTSSGKWTPELTKLCEPYHSSSDHPLVCYQVPKEVGKIGTESPTFVQPVKDRKDGIQAMFAKQQKPQPQLTAASSTADPTPPRPERVRKRSASPADLKPPGTTGESQTKKLKVEKLDTWEDDSDVEYVDDPPAAGRSAAGGGEDRKARLHSAALSAPKRSNNHPAKDTHNETPPKVRNAGSNKTPKPSTPRKSKDAQQTDSSPKITAFFAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.52
3 0.51
4 0.52
5 0.5
6 0.48
7 0.42
8 0.4
9 0.38
10 0.3
11 0.25
12 0.2
13 0.18
14 0.16
15 0.14
16 0.13
17 0.12
18 0.12
19 0.1
20 0.08
21 0.09
22 0.09
23 0.11
24 0.17
25 0.26
26 0.31
27 0.38
28 0.42
29 0.48
30 0.51
31 0.54
32 0.56
33 0.53
34 0.5
35 0.49
36 0.45
37 0.42
38 0.4
39 0.36
40 0.29
41 0.29
42 0.28
43 0.28
44 0.36
45 0.38
46 0.44
47 0.49
48 0.58
49 0.58
50 0.67
51 0.7
52 0.7
53 0.74
54 0.73
55 0.74
56 0.7
57 0.64
58 0.59
59 0.55
60 0.47
61 0.38
62 0.3
63 0.23
64 0.16
65 0.16
66 0.11
67 0.06
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.06
75 0.06
76 0.07
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.08
84 0.08
85 0.09
86 0.1
87 0.12
88 0.12
89 0.13
90 0.12
91 0.12
92 0.12
93 0.16
94 0.2
95 0.2
96 0.24
97 0.28
98 0.28
99 0.28
100 0.32
101 0.3
102 0.27
103 0.26
104 0.22
105 0.17
106 0.18
107 0.15
108 0.11
109 0.09
110 0.07
111 0.06
112 0.06
113 0.06
114 0.05
115 0.06
116 0.07
117 0.11
118 0.13
119 0.13
120 0.14
121 0.16
122 0.17
123 0.25
124 0.26
125 0.26
126 0.29
127 0.32
128 0.32
129 0.33
130 0.33
131 0.3
132 0.3
133 0.27
134 0.23
135 0.23
136 0.27
137 0.25
138 0.23
139 0.19
140 0.18
141 0.17
142 0.18
143 0.15
144 0.14
145 0.16
146 0.15
147 0.16
148 0.17
149 0.16
150 0.15
151 0.16
152 0.13
153 0.14
154 0.14
155 0.14
156 0.12
157 0.13
158 0.13
159 0.12
160 0.14
161 0.14
162 0.22
163 0.27
164 0.29
165 0.28
166 0.28
167 0.36
168 0.36
169 0.33
170 0.33
171 0.29
172 0.29
173 0.34
174 0.35
175 0.28
176 0.29
177 0.33
178 0.33
179 0.36
180 0.36
181 0.32
182 0.33
183 0.35
184 0.33
185 0.32
186 0.25
187 0.22
188 0.19
189 0.18
190 0.15
191 0.14
192 0.13
193 0.12
194 0.2
195 0.21
196 0.26
197 0.31
198 0.41
199 0.5
200 0.59
201 0.67
202 0.62
203 0.66
204 0.71
205 0.7
206 0.68
207 0.63
208 0.6
209 0.58
210 0.58
211 0.52
212 0.42
213 0.38
214 0.32
215 0.27
216 0.22
217 0.19
218 0.26
219 0.28
220 0.32
221 0.36
222 0.38
223 0.39
224 0.43
225 0.45
226 0.41
227 0.45
228 0.46
229 0.47
230 0.51
231 0.49
232 0.48
233 0.42
234 0.36
235 0.3
236 0.26
237 0.19
238 0.13
239 0.12
240 0.08
241 0.08
242 0.08
243 0.07
244 0.06
245 0.07
246 0.07
247 0.07
248 0.07
249 0.06
250 0.07
251 0.07
252 0.08
253 0.08
254 0.09
255 0.1
256 0.14
257 0.16
258 0.16
259 0.17
260 0.18
261 0.19
262 0.19
263 0.2
264 0.18
265 0.21
266 0.25
267 0.31
268 0.32
269 0.34
270 0.36
271 0.4
272 0.41
273 0.42
274 0.48
275 0.49
276 0.54
277 0.56
278 0.57
279 0.58
280 0.64
281 0.65
282 0.61
283 0.61
284 0.58
285 0.56
286 0.62
287 0.61
288 0.57
289 0.54
290 0.5
291 0.5
292 0.53
293 0.59
294 0.58
295 0.61
296 0.61
297 0.64
298 0.65
299 0.61
300 0.63
301 0.66
302 0.66
303 0.67
304 0.71
305 0.7
306 0.76
307 0.79
308 0.81
309 0.8
310 0.75
311 0.71
312 0.71
313 0.73
314 0.7
315 0.63
316 0.53
317 0.43
318 0.39
319 0.34