Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2W7N4

Protein Details
Accession A0A1M2W7N4   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-77SGTPPPEAPKKPQKRRGKCMLFRLRDDHydrophilic
NLS Segment(s)
PositionSequence
59-66PKKPQKRR
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 10.5, pero 3
Family & Domain DBs
Amino Acid Sequences MTGYDTIWPADSVEFCPHPDATDVFVVGTYKLEDSEKIETASTADDAPDDSGTPPPEAPKKPQKRRGKCMLFRLRDDDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.19
5 0.19
6 0.2
7 0.18
8 0.15
9 0.15
10 0.14
11 0.11
12 0.12
13 0.11
14 0.09
15 0.09
16 0.07
17 0.06
18 0.06
19 0.07
20 0.07
21 0.09
22 0.12
23 0.12
24 0.13
25 0.12
26 0.11
27 0.11
28 0.11
29 0.09
30 0.06
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.09
39 0.1
40 0.11
41 0.11
42 0.15
43 0.22
44 0.25
45 0.32
46 0.41
47 0.51
48 0.6
49 0.7
50 0.77
51 0.81
52 0.88
53 0.91
54 0.91
55 0.88
56 0.89
57 0.89
58 0.85
59 0.79