Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8YR44

Protein Details
Accession G8YR44    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHKNGIKKPKTHHydrophilic
NLS Segment(s)
PositionSequence
14-59KKAHKNGIKKPKTHKYPSLKGVDAKFRRNHRYALHGTAKALAKARA
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHKNGIKKPKTHKYPSLKGVDAKFRRNHRYALHGTAKALAKARAEKAGSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.82
4 0.8
5 0.79
6 0.8
7 0.84
8 0.81
9 0.78
10 0.79
11 0.79
12 0.79
13 0.76
14 0.76
15 0.74
16 0.74
17 0.75
18 0.71
19 0.62
20 0.57
21 0.53
22 0.53
23 0.48
24 0.47
25 0.46
26 0.48
27 0.53
28 0.52
29 0.54
30 0.47
31 0.52
32 0.49
33 0.52
34 0.51
35 0.45
36 0.43
37 0.44
38 0.42
39 0.37
40 0.35
41 0.29
42 0.27
43 0.31
44 0.33
45 0.34