Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VWS0

Protein Details
Accession A0A1M2VWS0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-71RDSGKPRQTTHRTRRPAWKYLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, extr 6, mito 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MASQLAYCIILSLELIVSDYPIRHLAARLSLRQYVTPPAKAKIRYLSNIMRDSGKPRQTTHRTRRPAWKYLGILAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.06
6 0.07
7 0.08
8 0.09
9 0.1
10 0.1
11 0.11
12 0.11
13 0.18
14 0.21
15 0.22
16 0.23
17 0.25
18 0.25
19 0.25
20 0.25
21 0.25
22 0.25
23 0.27
24 0.25
25 0.26
26 0.3
27 0.3
28 0.31
29 0.31
30 0.32
31 0.3
32 0.34
33 0.37
34 0.38
35 0.39
36 0.37
37 0.33
38 0.31
39 0.34
40 0.37
41 0.38
42 0.35
43 0.36
44 0.46
45 0.53
46 0.62
47 0.67
48 0.69
49 0.71
50 0.75
51 0.83
52 0.8
53 0.79
54 0.75
55 0.73
56 0.66