Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VF96

Protein Details
Accession A0A1M2VF96   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
135-159NILTPPKKKSALRKVWKRSCSHGKHHydrophilic
NLS Segment(s)
PositionSequence
140-149PKKKSALRKV
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004014  ATPase_P-typ_cation-transptr_N  
IPR023298  ATPase_P-typ_TM_dom_sf  
Pfam View protein in Pfam  
PF00690  Cation_ATPase_N  
Amino Acid Sequences MDDAHGITEKPVHPAHDEEAAAATRAVAFPDRYVHDDGQEKAPHGMRPRGVEMKREMTKEEKELAEAGYQDLAEQKAGAKGGDAGLDAVDLHEHKLTLTALEAELDTAFDPKDPTQSPGLSADEAKARLARDGPNILTPPKKKSALRKVWKRSCSHGKHALTAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.28
4 0.27
5 0.23
6 0.24
7 0.22
8 0.19
9 0.16
10 0.13
11 0.09
12 0.09
13 0.09
14 0.09
15 0.1
16 0.1
17 0.15
18 0.17
19 0.2
20 0.25
21 0.24
22 0.26
23 0.29
24 0.3
25 0.33
26 0.32
27 0.29
28 0.28
29 0.3
30 0.3
31 0.3
32 0.33
33 0.29
34 0.31
35 0.36
36 0.41
37 0.4
38 0.41
39 0.41
40 0.45
41 0.46
42 0.43
43 0.4
44 0.36
45 0.37
46 0.35
47 0.34
48 0.26
49 0.23
50 0.22
51 0.21
52 0.17
53 0.14
54 0.12
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.05
62 0.06
63 0.06
64 0.07
65 0.06
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.07
98 0.07
99 0.12
100 0.13
101 0.16
102 0.19
103 0.19
104 0.2
105 0.22
106 0.23
107 0.19
108 0.18
109 0.17
110 0.17
111 0.17
112 0.16
113 0.16
114 0.14
115 0.15
116 0.18
117 0.19
118 0.21
119 0.25
120 0.25
121 0.28
122 0.29
123 0.31
124 0.37
125 0.37
126 0.38
127 0.41
128 0.46
129 0.48
130 0.56
131 0.64
132 0.67
133 0.75
134 0.8
135 0.84
136 0.87
137 0.9
138 0.84
139 0.82
140 0.82
141 0.79
142 0.78
143 0.77
144 0.7
145 0.67