Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VLW3

Protein Details
Accession A0A1M2VLW3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-53VKKGRTCEGRHNRPRPRALABasic
NLS Segment(s)
PositionSequence
43-57RHNRPRPRALARRRP
Subcellular Location(s) mito 11, nucl 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MGEEASRPWAPPAARERMGAFEGALMRAHAVTNVKKGRTCEGRHNRPRPRALARRRPGLANGRLVAHLFAHCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.37
3 0.37
4 0.35
5 0.35
6 0.29
7 0.22
8 0.16
9 0.14
10 0.13
11 0.12
12 0.08
13 0.08
14 0.08
15 0.08
16 0.07
17 0.1
18 0.1
19 0.18
20 0.21
21 0.22
22 0.24
23 0.25
24 0.3
25 0.34
26 0.36
27 0.4
28 0.47
29 0.57
30 0.66
31 0.74
32 0.77
33 0.78
34 0.8
35 0.76
36 0.76
37 0.75
38 0.76
39 0.77
40 0.75
41 0.75
42 0.72
43 0.67
44 0.64
45 0.63
46 0.58
47 0.54
48 0.48
49 0.41
50 0.4
51 0.38
52 0.32
53 0.24