Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VAH8

Protein Details
Accession A0A1M2VAH8    Localization Confidence High Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
122-148GKRPLKSGSGSRRRRRRCAPANVPVRCHydrophilic
161-182QMGARRAARLRRKMGRTKKISHBasic
NLS Segment(s)
PositionSequence
116-138ARSPRSGKRPLKSGSGSRRRRRR
165-182RRAARLRRKMGRTKKISH
Subcellular Location(s) nucl 20, mito 4, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSESELNLQLPADPPVQSTSTSAGDATVVALAHSVSGRVSGKAWKVPKTATVRSHLPEGVKTKKWEERMEKTRKEQAIKKLQSELKQEKVDDLKRYAPSPSLCSTQSDVPAPPAAARSPRSGKRPLKSGSGSRRRRRRCAPANVPVRCYAIAHLRGIPLLQMGARRAARLRRKMGRTKKISH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.18
4 0.18
5 0.18
6 0.19
7 0.19
8 0.19
9 0.17
10 0.14
11 0.13
12 0.12
13 0.11
14 0.08
15 0.06
16 0.05
17 0.06
18 0.05
19 0.06
20 0.06
21 0.05
22 0.04
23 0.08
24 0.09
25 0.09
26 0.11
27 0.15
28 0.18
29 0.25
30 0.3
31 0.31
32 0.33
33 0.34
34 0.4
35 0.43
36 0.47
37 0.45
38 0.46
39 0.45
40 0.44
41 0.46
42 0.4
43 0.34
44 0.31
45 0.33
46 0.34
47 0.34
48 0.35
49 0.37
50 0.41
51 0.45
52 0.49
53 0.51
54 0.54
55 0.6
56 0.67
57 0.67
58 0.67
59 0.69
60 0.65
61 0.63
62 0.59
63 0.59
64 0.6
65 0.58
66 0.54
67 0.54
68 0.53
69 0.52
70 0.54
71 0.49
72 0.44
73 0.43
74 0.41
75 0.37
76 0.39
77 0.38
78 0.32
79 0.3
80 0.28
81 0.28
82 0.28
83 0.26
84 0.24
85 0.22
86 0.23
87 0.23
88 0.21
89 0.2
90 0.21
91 0.23
92 0.21
93 0.21
94 0.19
95 0.17
96 0.16
97 0.16
98 0.14
99 0.12
100 0.12
101 0.11
102 0.14
103 0.15
104 0.2
105 0.26
106 0.31
107 0.36
108 0.44
109 0.5
110 0.51
111 0.57
112 0.54
113 0.55
114 0.55
115 0.59
116 0.6
117 0.63
118 0.69
119 0.71
120 0.78
121 0.79
122 0.84
123 0.84
124 0.84
125 0.84
126 0.85
127 0.84
128 0.84
129 0.86
130 0.8
131 0.73
132 0.65
133 0.57
134 0.46
135 0.37
136 0.3
137 0.28
138 0.28
139 0.27
140 0.26
141 0.24
142 0.24
143 0.23
144 0.21
145 0.13
146 0.1
147 0.1
148 0.11
149 0.12
150 0.19
151 0.19
152 0.21
153 0.26
154 0.35
155 0.44
156 0.5
157 0.59
158 0.61
159 0.7
160 0.79
161 0.85
162 0.86