Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1M2VW79

Protein Details
Accession A0A1M2VW79   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-70FAKIRKHETRREWKREKTGGBasic
NLS Segment(s)
PositionSequence
55-64RKHETRREWK
Subcellular Location(s) cysk 14, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MEAPGALESGVSVWRISLFLMDRWGPEPEGWSLPKRYGARWENARRLTSQFAKIRKHETRREWKREKTGGETPEYELSAQVGRRSHRTETVIDSRATKSFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.1
5 0.11
6 0.11
7 0.15
8 0.16
9 0.16
10 0.18
11 0.2
12 0.17
13 0.16
14 0.17
15 0.15
16 0.18
17 0.19
18 0.2
19 0.21
20 0.21
21 0.28
22 0.27
23 0.26
24 0.32
25 0.34
26 0.37
27 0.46
28 0.52
29 0.53
30 0.55
31 0.55
32 0.47
33 0.46
34 0.44
35 0.37
36 0.37
37 0.34
38 0.37
39 0.4
40 0.41
41 0.47
42 0.5
43 0.54
44 0.55
45 0.6
46 0.65
47 0.71
48 0.79
49 0.79
50 0.79
51 0.8
52 0.78
53 0.72
54 0.68
55 0.65
56 0.58
57 0.53
58 0.47
59 0.4
60 0.36
61 0.33
62 0.26
63 0.19
64 0.17
65 0.15
66 0.15
67 0.16
68 0.17
69 0.19
70 0.26
71 0.3
72 0.32
73 0.36
74 0.38
75 0.38
76 0.43
77 0.48
78 0.46
79 0.43
80 0.42
81 0.38