Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VZN3

Protein Details
Accession A0A1M2VZN3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23RVACTDKAKKLCKSKTEKKTTCMHydrophilic
NLS Segment(s)
PositionSequence
42-57EKRLREPVGTKRERER
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences RVACTDKAKKLCKSKTEKKTTCMAKAERSEISARWRKSEEEEKRLREPVGTKRERERGAERAWVWGRGSEAGSNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.86
4 0.82
5 0.76
6 0.77
7 0.73
8 0.7
9 0.67
10 0.59
11 0.56
12 0.54
13 0.54
14 0.45
15 0.41
16 0.35
17 0.29
18 0.35
19 0.34
20 0.31
21 0.31
22 0.32
23 0.3
24 0.34
25 0.43
26 0.41
27 0.43
28 0.49
29 0.5
30 0.52
31 0.53
32 0.48
33 0.4
34 0.38
35 0.38
36 0.43
37 0.42
38 0.43
39 0.48
40 0.56
41 0.56
42 0.57
43 0.53
44 0.49
45 0.48
46 0.52
47 0.45
48 0.47
49 0.46
50 0.43
51 0.38
52 0.33
53 0.31
54 0.26
55 0.27
56 0.2