Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2W6M7

Protein Details
Accession A0A1M2W6M7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-80QQPAPAVKGKYKKKQKVRHPRNTAELSRHydrophilic
164-188APIPPPKQTYKERRRKVIARDPPLFHydrophilic
NLS Segment(s)
PositionSequence
60-72KGKYKKKQKVRHP
Subcellular Location(s) nucl 19, cyto_nucl 13.833, mito_nucl 10.999, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAKKNKDNEPVANLHSVANRDIIQRINFLYQASAYLNSVSQALPSSAENVQPQQPAPAVKGKYKKKQKVRHPRNTAELSRSYIGSMRTVGQKTMGPVSQANAVQELRYSFASRFDSHRACQTPDGTPPDDGAVIVDTKPAASTSAPQVGAEASVMDVDTQSAEAPIPPPKQTYKERRRKVIARDPPLFERAGHVVFRGNERLPDDASAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.3
4 0.24
5 0.23
6 0.21
7 0.2
8 0.22
9 0.24
10 0.22
11 0.23
12 0.24
13 0.24
14 0.23
15 0.21
16 0.2
17 0.15
18 0.16
19 0.15
20 0.14
21 0.12
22 0.12
23 0.11
24 0.11
25 0.12
26 0.09
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.12
33 0.12
34 0.14
35 0.15
36 0.17
37 0.2
38 0.2
39 0.2
40 0.19
41 0.2
42 0.19
43 0.2
44 0.24
45 0.23
46 0.28
47 0.37
48 0.44
49 0.52
50 0.62
51 0.69
52 0.73
53 0.8
54 0.85
55 0.88
56 0.9
57 0.91
58 0.9
59 0.85
60 0.83
61 0.8
62 0.72
63 0.65
64 0.56
65 0.48
66 0.4
67 0.34
68 0.26
69 0.21
70 0.19
71 0.15
72 0.14
73 0.12
74 0.16
75 0.16
76 0.16
77 0.15
78 0.15
79 0.16
80 0.17
81 0.16
82 0.12
83 0.12
84 0.13
85 0.14
86 0.14
87 0.13
88 0.12
89 0.12
90 0.1
91 0.11
92 0.1
93 0.08
94 0.08
95 0.1
96 0.08
97 0.12
98 0.15
99 0.16
100 0.19
101 0.23
102 0.25
103 0.25
104 0.31
105 0.29
106 0.28
107 0.3
108 0.29
109 0.25
110 0.27
111 0.31
112 0.26
113 0.24
114 0.22
115 0.2
116 0.18
117 0.16
118 0.11
119 0.07
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06
129 0.08
130 0.11
131 0.16
132 0.16
133 0.16
134 0.16
135 0.15
136 0.15
137 0.13
138 0.09
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.05
151 0.07
152 0.14
153 0.16
154 0.18
155 0.21
156 0.25
157 0.32
158 0.42
159 0.51
160 0.56
161 0.64
162 0.72
163 0.78
164 0.83
165 0.84
166 0.85
167 0.85
168 0.84
169 0.82
170 0.8
171 0.76
172 0.7
173 0.65
174 0.55
175 0.44
176 0.38
177 0.33
178 0.3
179 0.25
180 0.21
181 0.24
182 0.25
183 0.3
184 0.31
185 0.28
186 0.29
187 0.31
188 0.33
189 0.29