Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1M2VCN0

Protein Details
Accession A0A1M2VCN0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-35RLRFSYCPSKFKRTRKRGGGRPAPTLHydrophilic
NLS Segment(s)
PositionSequence
20-32FKRTRKRGGGRPA
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MGEKSRELSRLRFSYCPSKFKRTRKRGGGRPAPTLMIPGAPARSLRNNKPILLRRIPLQTQACRRRGSIGGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.57
4 0.55
5 0.6
6 0.64
7 0.72
8 0.79
9 0.78
10 0.83
11 0.85
12 0.88
13 0.87
14 0.88
15 0.87
16 0.8
17 0.75
18 0.66
19 0.56
20 0.45
21 0.37
22 0.26
23 0.16
24 0.13
25 0.09
26 0.08
27 0.07
28 0.08
29 0.1
30 0.18
31 0.23
32 0.27
33 0.35
34 0.37
35 0.39
36 0.48
37 0.53
38 0.53
39 0.53
40 0.5
41 0.46
42 0.51
43 0.5
44 0.49
45 0.48
46 0.49
47 0.54
48 0.62
49 0.63
50 0.58
51 0.58
52 0.55